(data stored in ACNUC7421 zone)

EMBL: AP010803.PE576

AP010803.PE576       Location/Qualifiers
FT   CDS_pept        complement(586672..587202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95410"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYH8"
FT                   /protein_id="BAI95410.1"
FT                   /translation="MNEMRWMTGSLIALALLTGGVASAQAFQPRNGAPQEQDDLSDEAQ
FT                   PPADDPGPPQADDDFSDVVAADQERGGAAAPSERYGSQDDPAGAAPADRESEDAITYCA
FT                   LAARDEAERDGGYAEVRQVQEPRETRNGYDVEGDVEIRSGWRTQDGRSRHFTCSVQNGR
FT                   IADLYFRRDRAAR"
     atgaacgaga tgaggtggat gacgggttcg ctgatcgcgc tggcgctgct gacgggaggc        60
     gtcgcatcgg cgcaggcctt ccagccgcgg aacggcgcgc cgcaggagca ggacgacctg       120
     tcggacgagg cgcagccgcc cgccgatgac cccggcccgc cgcaggcgga cgacgacttc       180
     tccgacgtgg tggcggcgga ccaggaacgt ggcggcgcgg ccgcgccctc cgagcgctac       240
     ggctcccagg acgatcctgc aggcgcagcc cccgccgacc gggaaagcga ggatgcgatc       300
     acctactgcg cgctcgccgc ccgcgacgag gccgagcgcg acggcggcta tgccgaggtg       360
     cgccaggtgc aggaaccccg cgagacccgc aacggctatg acgtggaggg cgatgtggag       420
     attcggtccg gctggcggac gcaggacggc cgttcgcgcc acttcacctg ttcggtgcag       480
     aatggccgga tcgcggacct ttatttccgg cgggatcgcg ccgcccgata a                531
//

If you have problems or comments...

PBIL Back to PBIL home page