(data stored in ACNUC7421 zone)

EMBL: AP010803.PE582

AP010803.PE582       Location/Qualifiers
FT   CDS_pept        592662..593201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95416"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI4"
FT                   /protein_id="BAI95416.1"
FT                   /translation="MRFTLPSAMPTAAFVLLASCVGAPQQRAPAPAPAPRPTPAARPAP
FT                   PPPPPADWQDRATTAGDWRYQVDGAGSAALFGADGQSSLLIIRCDRPTRRITLLRPGAV
FT                   QAAMTVRTSYGAVNWPAGAAPGTIAATEATRAASDATLDQIAYSRGRFAVEVQGLEMLV
FT                   LPSWAEVGRVVEDCRG"
     atgcgcttca ctctgccctc cgccatgccg acggccgcct tcgtcctgct ggcctcctgc        60
     gtcggcgcgc cccagcagcg cgcgcctgcg cccgcgcccg cgcccaggcc gaccccggcg       120
     gcccggcctg ctccgcctcc gcccccgccg gccgactggc aggaccgggc gacgaccgcg       180
     ggcgactggc gctatcaggt cgacggcgcc ggatcggccg ccctgttcgg cgcggatggg       240
     caaagcagcc tgctcatcat ccgctgcgac cggccgacgc gccgcatcac ccttttgcgg       300
     cccggcgcgg tgcaggcggc catgacggtg cggaccagct atggcgcggt caactggccc       360
     gccggcgccg cccccggaac catcgcggcg acagaggcga cccgcgccgc cagcgacgcg       420
     acgctggacc agatcgccta cagccggggc cgtttcgcgg tcgaggtgca ggggttggag       480
     atgctggtgc tgccaagctg ggcggaggtc ggccgcgtcg tcgaggactg ccgcggctaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page