(data stored in SCRATCH zone)

EMBL: AP010803.PE585

AP010803.PE585       Location/Qualifiers
FT   CDS_pept        complement(596357..596626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95419"
FT                   /db_xref="GOA:D4YYI7"
FT                   /db_xref="InterPro:IPR021497"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI7"
FT                   /protein_id="BAI95419.1"
FT                   /translation="MTSSRRRIAGDRWTLRARPAFLYVMYGLLLWSVPLGLIGGVRPDV
FT                   AAEIIRAMRAYFNALPEPLYALFGTGYLGYTAARAWGKAKGVER"
     atgacctctt cacgcaggcg aatcgcgggg gatcggtgga cgctgcgggc gcggccggcc        60
     tttctctatg tcatgtacgg gttgctgctg tggtcggtgc cgctggggct gatcggcggg       120
     gtgcggcccg acgtggcggc ggagatcatt cgggcgatgc gggcctattt caacgccctg       180
     ccggagccgc tctatgccct cttcgggacg ggctatctgg gctatacggc ggcgcgggcc       240
     tgggggaagg ccaagggggt ggagcggtaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page