(data stored in ACNUC7421 zone)

EMBL: AP010803.PE586

AP010803.PE586       Location/Qualifiers
FT   CDS_pept        complement(596637..597209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05860"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative secretion activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95420"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYI8"
FT                   /protein_id="BAI95420.1"
FT                   /translation="MIRLSATGGRFMDIAALIDEVIAREGGYSNHPADRGGPTHFGITQ
FT                   AVARANGYGGDMRAMPRTVAEAIYRRLYWERPGFAFVAELAPAVAEELFDTAVNMGPGT
FT                   AGGFLQRALNALNRNGRDYPDLKVDQAVGAKTIAALGAFLAVRGRAGEKVLLKALEALQ
FT                   GERYLALAESRPANEAFLYGWLANRIG"
     atgatccgcc tttccgcaac aggagggcgt ttcatggata ttgcggctct gatcgacgag        60
     gtcatcgcgc gggagggtgg ttacagcaac catccggcgg atcgcggcgg acccactcat       120
     ttcggcatca cccaggccgt ggcgcgggcg aacggctatg gcggcgacat gcgggcgatg       180
     ccccggacgg ttgccgaggc gatctatcgc aggctctatt gggaaaggcc gggcttcgcc       240
     ttcgtcgccg aactggcgcc ggccgtggcg gaggagctgt tcgacacggc ggtgaacatg       300
     gggccgggca ccgccggcgg cttcctgcaa cgggcgttga acgcgctcaa ccgcaacggg       360
     cgggactatc ccgacctgaa ggtggaccag gccgtgggcg cgaagacgat cgccgcgctg       420
     ggcgcctttc tggccgttcg cgggcgggcg ggcgagaagg tgctgctcaa ggcgctcgaa       480
     gcgctccaag gcgagcgcta tctggcgctg gccgagagca ggcccgccaa cgaggccttt       540
     ctttacggct ggctcgccaa ccgcattggt tag                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page