(data stored in ACNUC7421 zone)

EMBL: AP010803.PE590

AP010803.PE590       Location/Qualifiers
FT   CDS_pept        600658..600927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-05900"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95424"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYJ2"
FT                   /protein_id="BAI95424.1"
FT                   /translation="MRALAWRDAPAVDALTVAHLGDLFDLEIQPEFLLVGTGAGLRQPP
FT                   RAFVRELEGRGIGVEAMDSRAAARAWGVLRAEDRWIVAALMPLV"
     gtgcgggcgc tcgcctggcg ggacgcgccg gccgtcgacg cgctgacggt ggcgcatctg        60
     ggcgacctgt tcgaccttga aatccagccc gaattcctgc tggtcggcac cggcgcgggc       120
     ctgcgacagc cgccccgcgc cttcgtgcgc gaactggaag gacgcggcat cggcgtggag       180
     gcgatggaca gccgcgccgc cgcccgcgcc tggggcgtgc tgcgcgccga ggatcggtgg       240
     atcgtcgcgg ccctcatgcc gcttgtctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page