(data stored in ACNUC7421 zone)

EMBL: AP010803.PE601

AP010803.PE601       Location/Qualifiers
FT   CDS_pept        complement(612521..614584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06010"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95435"
FT                   /db_xref="GOA:D4YYK3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYK3"
FT                   /protein_id="BAI95435.1"
FT                   /translation="MDRLTEDNRLSGAPGIAEMIAAQGALGALTARIDAGSPLGPVNGW
FT                   SPALVSTVRLMLSSQAEIVLFWGPELCALYNEAYAPTIGDKHPRVLGRPAREGWTELWD
FT                   DLEPLLRSVIDRGQSVHAKDRPFYIERDGGQGEQVFFDINYSPVFEADGSVGGALCIVS
FT                   ETTKRVLAEKEMRADRARLWALARDPFLVADRDGTWLAASPAWTDILGWSEAELIGRTS
FT                   EWMEHPDDLEKTKGEIAGLARGTPTVRFENRFRAKDGSYRNFSWTAVPENDLIYCVARD
FT                   VTEQRAHARALAEAEEALRQAQKMETLGQLTGGVAHDFNNLLQIVTGNLELLQRGLNED
FT                   QARLRRAADNAMAGAERAALLTQRLLAFARRQPLAPERIDPNRLVSGMSDMLNRTLGET
FT                   IEVETIQSARIWPIEIDVNQMENALLNLAVNARDAMPDGGKLTIEVANTHIDEDYAAQE
FT                   AEVSPGQYVLISVSDTGEGMDEEVLSHAIEPFFTTKEVGRGTGLGLSMVYGFIKQSGGH
FT                   IRVYSESGHGTTVKIYLPRFYGPLPDNDTGVAERTAPVCGGDETVLVCEDDDKVRAYTV
FT                   DVLKELGYRVIEANDGAAALRALDAASQSIDLLFTDVILPGGMTGADIAQQARAQQPGL
FT                   KVLFATGYARNAIIHHGRLDPGVELLTKPFTYAELATKVRDMLDRDEARQVG"
     atggacaggc tgaccgagga taaccgattg agcggcgcgc cgggcatagc ggagatgatc        60
     gccgcccagg gcgcattggg cgcgctcacc gcccgcatcg acgcgggatc gccgctgggg       120
     ccggtgaacg gctggtcgcc cgcgctggtg tcgaccgtgc ggctgatgct gtcgtcgcag       180
     gcggagatcg tgctgttctg gggcccggaa ctctgcgcgc tctataacga agcctatgcg       240
     cccaccatcg gagacaagca tccccgcgtg ctgggccgcc cggcgcggga ggggtggacg       300
     gaattgtggg acgacctgga gccgctgctg cgttccgtca tcgaccgggg ccagtcggtg       360
     catgccaagg accgcccctt ctatatcgag cgggacggcg gacagggcga acaggtgttc       420
     ttcgacatca actattcccc ggtgttcgag gcggacggct ccgtcggcgg cgcgctgtgc       480
     atcgtcagcg agacgaccaa gcgcgtgctg gccgaaaagg agatgcgggc cgaccgcgcc       540
     cggctctggg cgctggcgcg cgatcccttc ctggtcgccg accgggacgg cacctggctg       600
     gcggccagtc cggcctggac cgacatattg ggatggagcg aggcggaact gatcggccgc       660
     acgtccgaat ggatggagca tcccgacgac ctggagaaga ccaagggcga gatcgccggg       720
     ctggcgcggg gcacgccgac ggtgcggttc gaaaaccgat tccgggcgaa ggacggcagc       780
     taccgcaatt tcagttggac ggcggtgccg gaaaacgacc ttatctattg cgtcgcccgc       840
     gacgtgaccg agcagcgcgc ccatgccagg gcgctggcgg aggcggaaga ggcgctgcgg       900
     caggcgcaga agatggagac gctgggccag ctgaccggcg gcgtggcgca tgatttcaac       960
     aatctgctgc agatcgtcac cggcaatctg gaactgctgc aacgcggcct gaacgaggac      1020
     caggcgcggc tgcggcgcgc cgccgacaac gccatggcgg gcgcggagcg ggccgctttg      1080
     ctgacgcagc gcctgctcgc ctttgccagg cgccagccgc tggcgcccga gcggatcgac      1140
     cccaaccggc tggtgagcgg catgtcggac atgctcaacc gcacattggg cgagacgata      1200
     gaggtggaga cgatccagag cgcgcgcatc tggccgatcg agatcgacgt caaccagatg      1260
     gagaatgcgc tgctgaacct ggcggtgaat gcccgcgacg ccatgccgga cggcggcaag      1320
     ctgaccatag aggtcgccaa cacccatatc gacgaggatt atgccgcgca ggaggcggag      1380
     gtttcccccg gccaatatgt gctgatcagc gtgtccgaca ccggcgaggg catggacgaa      1440
     gaggtgctga gccacgccat cgaacccttc ttcaccacca aggaggtcgg acggggcact      1500
     ggcctgggcc tgtcgatggt ctatggcttc atcaagcagt cgggcgggca tatccgcgtc      1560
     tattccgaaa gcggccatgg cacgacggtc aagatctacc tgccccgctt ctacggtccc      1620
     ctgcccgaca atgacacggg ggtcgccgaa cgcaccgcgc cggtgtgcgg cggcgacgag      1680
     acggtgctgg tgtgcgagga cgacgacaag gtgcgcgcct ataccgtcga cgtgctgaag      1740
     gaactgggct atcgggtgat cgaggcgaat gacggcgcgg cggcgctgcg ggcgctggac      1800
     gcggcgtcgc aatccatcga cctgctgttc accgacgtca tcctgcccgg cggcatgacc      1860
     ggggccgaca tcgcgcaaca ggcgcgggcg cagcaaccgg ggctgaaggt gctgttcgcc      1920
     accggctatg cgcgcaacgc catcatccat cacggccgtc tcgacccggg cgtggaactg      1980
     ctgaccaagc ccttcaccta tgcggagctg gcgaccaagg tgcgcgacat gctggaccgg      2040
     gacgaggcgc ggcaggtggg gtga                                             2064
//

If you have problems or comments...

PBIL Back to PBIL home page