(data stored in ACNUC7421 zone)

EMBL: AP010803.PE606

AP010803.PE606       Location/Qualifiers
FT   CDS_pept        complement(618840..619307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95440"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYK8"
FT                   /protein_id="BAI95440.1"
FT                   /translation="MEMSILKTLKLTAATRNAPLTPEQMLRGKLVSYLNEQKSLAEAET
FT                   AGTSFVATKKVTRKNAEGENIRVDAPRHVRKGWFTDADGKMFFQIRYGSKPLELTKGMN
FT                   AVEVENLAELPSLIVSIIEAINAGELDVQAKAANADRKTQRKAKQATASCN"
     atggaaatgt cgatcctcaa gaccctcaag ctgaccgctg ccacccgcaa tgcgcccctg        60
     acgccagagc agatgctacg cggcaagctg gtcagctatc tcaacgaaca gaaatcgctc       120
     gcggaagcgg aaaccgccgg aacgtccttt gtcgcgacca agaaggtcac gcgcaagaac       180
     gctgagggcg agaacatccg cgttgatgcg ccgcgccatg ttcgcaaggg ctggttcacg       240
     gatgcagacg gcaagatgtt cttccagatt cgctatggta gcaagccgct ggaattgacg       300
     aagggcatga acgccgtcga ggttgagaac ctcgcggaac tgcccagtct gatcgtgtcg       360
     atcatcgagg ccatcaatgc tggcgaattg gacgtgcagg cgaaggccgc aaacgccgac       420
     cgcaagaccc agcgcaaagc caagcaggct acggcctcat gcaattga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page