(data stored in SCRATCH zone)

EMBL: AP010803.PE607

AP010803.PE607       Location/Qualifiers
FT   CDS_pept        619501..620403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95441"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYK9"
FT                   /protein_id="BAI95441.1"
FT                   /translation="MAMVLRALKLVPMVYQFSHSLGVWQGVVVSMCPHAPTSHKSSFCK
FT                   RLIATLENRKGTSARVTRLGNYLCSRKWMSAASLLLLTGLATSACSYVPQKYHYELIVK
FT                   VMRDGKSYVGSSVREVIVSRQGGALFSFMASKPYRARLIGEAVVVDLGELGHVFTLLRR
FT                   AEPGEGLVYDQGCTGDAVTNYIMNYHKKADCSQSPMESADFVKNIGRPILFSGPTTPTS
FT                   IILQNSDNPYSLKYLDNTFEVEMYISVTDKPYKHKISMLFPWIKNFMGRRFTYNPATGN
FT                   DYLLATIGGSEFISGGTGE"
     gtggctatgg tgcttcgggc gttgaagctg gttccgatgg tgtaccaatt ttcgcattcc        60
     ttaggcgtat ggcaaggggt ggtggtttcg atgtgtcccc acgcgccgac ctcccacaaa       120
     agttcatttt gcaagcggct gatcgcgacg ctagaaaatc gcaaggggac aagcgcaaga       180
     gtgacgcgct taggcaatta tctttgttcc aggaaatgga tgagcgctgc gtccctgctt       240
     cttctaacgg gccttgctac atctgcctgc tcctatgtgc cgcagaagta tcactatgaa       300
     ttgatagtaa aggtgatgag agacggaaaa tcttacgttg gatcaagcgt aagagaagtc       360
     atcgtttcaa gacaaggagg ggctctattt tcctttatgg cgtctaaacc ttatcgagct       420
     agattaattg gagaggcggt tgtagttgat ttgggtgagc tcggtcatgt gttcactctg       480
     cttaggcggg cagagcccgg cgaaggcttg gtgtatgatc aaggttgcac tggggatgcg       540
     gttacaaatt acataatgaa ttatcataaa aaagccgact gctctcaaag cccaatggaa       600
     tctgcggact tcgtaaagaa tatcggcagg cctatattat tctcaggacc cacaacgccg       660
     acatcgatta ttctccaaaa ctcggataat ccgtattcgt tgaaatacct tgataataca       720
     tttgaagttg agatgtatat atctgtcacg gacaagccat ataaacataa aataagtatg       780
     ttattccctt ggattaaaaa tttcatggga aggcggttca cctataatcc agcaaccgga       840
     aatgattatc ttttagccac gattggtgga tctgagttta tttcaggagg aactggtgaa       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page