(data stored in ACNUC7421 zone)

EMBL: AP010803.PE609

AP010803.PE609       Location/Qualifiers
FT   CDS_pept        623207..624976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06090"
FT                   /product="ATP-binding cassette protein"
FT                   /note="subfamily C, bacterial / ABC-type protease / lipase
FT                   transport system, ATPase and permease component / ABC-type
FT                   multidrug/protein/lipid transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95443"
FT                   /db_xref="GOA:D4YYL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL1"
FT                   /protein_id="BAI95443.1"
FT                   /translation="MFQLIPQLRAKSMVATNSDMLRHAVQKARRHFGAVATFSALLNAL
FT                   YITPTLYMLQVYDRVVPTQGLQTLLYLTLVLIFALITLSLLDRLRLRLLIRAGVKLDMI
FT                   VAPALLDATLGRPDLPSARQGLRDFDTLRSTLSGPAILGLFDAPWVPVYLLVCFLVHPW
FT                   IGVLAVVGCLLLPLVAFTTWRATRHKLAQAQLLASVSYASQDELLAAADGIRALGMRRA
FT                   LVTRQLRQREAMIATQTQASLAAGSFLTLGKFIRLALQSLALGLGALLAVDNLISTGAI
FT                   FASSFLIARALQPIEQLIATWKSLIQARQQYTDIRTLLATAPAARIKTTLPPPKGKISV
FT                   ENLTVMNEARDGAVLQNISLAIPAGEVVAVVGPSGAGKSTLIRAIAGALLPDRGKIRLD
FT                   DADAQDWDPEILARHIGYLPQDSTLLAGSIADNIARFSTEWGEDRTCLDTDVVAAASKV
FT                   GADALIRRFPNGYDHQLKSGGKGISAGQAQRIALARAVFGDPAILLLDEPNAHLDTEGD
FT                   AALIAALGALKAERKTVLVVSHKLGILPVVDRILVMRDGHMEMFGPRDEVLAKITPPNM
FT                   RRVPAPSVAKAAS"
     atgttccaat taatcccgca gttgcgagct aaatccatgg ttgctactaa cagcgatatg        60
     cttcgccacg ccgttcagaa ggcaaggcgg cactttggtg cagtcgcgac tttcagtgcc       120
     ctgctaaatg ctctctacat cacaccaacc ttatacatgt tgcaggtcta tgatcgggta       180
     gtacctaccc aaggtttgca aacgcttctg tacctgacat tggtactcat attcgcgctg       240
     ataacgctca gcctgcttga tcgccttcgc cttcgattgc tgatccgtgc gggagtgaag       300
     ctagatatga ttgttgcgcc agctttgctg gatgcgacct taggccgacc ggatctacct       360
     tctgcgcgtc aaggtctgcg cgatttcgac acattgcgca gtacattgag cggtcctgca       420
     attctgggac tgttcgacgc cccttgggtg cccgtttatc tgctggtatg cttcctagtc       480
     catccttgga ttggtgtttt agctgtggtg ggatgccttc tcctgcccct cgtcgctttt       540
     accacatggc gagcaacccg ccataaactg gcgcaggcgc aactactggc cagcgtttcc       600
     tatgcaagcc aggacgagtt gctggcagcg gcggatggca taagagcatt gggtatgcgg       660
     cgcgcgttgg tcacgcgcca gttgcgccaa cgtgaagcga tgatagcgac gcaaacgcag       720
     gccagcctcg ccgctggcag ctttctcaca cttggcaaat tcatcaggct agcgctgcaa       780
     tccctagctt tgggcttggg ggcgttgctg gccgtcgata atcttatatc aacaggtgcg       840
     atttttgcgt cctcctttct catcgcgcgc gcgcttcagc cgattgagca actgattgcg       900
     acatggaagt cgctaattca ggcacgccag caatatactg atatccggac actgctggcg       960
     accgctccgg ccgcaaggat caagactacg ctccctcctc caaaggggaa aatcagtgtc      1020
     gaaaacctca ccgttatgaa cgaggcccgt gatggcgcgg ttctccaaaa catctccctc      1080
     gctattccag caggtgaggt cgttgccgtt gttggtccca gcggcgctgg caaatcgaca      1140
     ctgatccgcg ccattgccgg tgcgctcctg cccgatcgag gaaagatacg gctcgatgat      1200
     gccgatgctc aggattggga cccggagatt ctcgcacgtc acatcggcta cctacctcaa      1260
     gattctacac tgctggcagg ttctattgcc gataatatcg cgcgcttctc taccgagtgg      1320
     ggagaggaca gaacttgcct tgacacagac gttgtggccg cggcgtcaaa ggtcggagcc      1380
     gacgctctga tccgccgttt tcccaatggc tatgaccatc agctcaaatc cggcggcaag      1440
     ggcatttccg ctggccaagc ccagcgcata gcattagcac gcgcggtctt tggtgatcct      1500
     gctattctcc ttctagatga acccaatgcc catctggata ccgaaggaga cgcagcgctg      1560
     atcgcagcgt tgggtgcatt gaaggcagag cgcaaaaccg ttcttgtcgt ctcgcataaa      1620
     ctcggcatcc tgccggtagt ggacaggata ttggtgatga gagatggaca catggaaatg      1680
     ttcggtccgc gcgacgaggt gctcgccaag ataacgccgc ccaatatgcg ccgcgtccct      1740
     gccccctcag tcgcgaaggc cgcctcatga                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page