(data stored in ACNUC7421 zone)

EMBL: AP010803.PE61

AP010803.PE61        Location/Qualifiers
FT   CDS_pept        complement(58416..60341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00610"
FT                   /product="trypsin-like serine protease"
FT                   /note="putative protease with the C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94895"
FT                   /db_xref="GOA:D4YX13"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX13"
FT                   /protein_id="BAI94895.1"
FT                   /translation="MFMIRSLAAALFLSTAISGPLIAQDAIRSRPVALPVDNAAPTPKD
FT                   VPYPGGTIRLEVDATDTVQRIFRVKETIPVAAAGPMTLLMPQWLPGNHAPRGQIEKLTG
FT                   LTFTADGKPLAWKRDPLNVFGFVIDVPQGVKQVVASFQFLSATQPNQGRVVVTPKMLNI
FT                   QWESVSLYPAGYYTRAIPIQATVTYPDGWQAATALRGKKTGSTVAYETIDYEALQDSPV
FT                   FAGLYFKPVDLGHNVTLNILADDAGELDAKPDQIAKHKKLVDEAGALFGAYHFDHYDFL
FT                   FAITDEMGGIGLEHHRSSENQVEPGYFKKWGDGAALLDRNLLPHEFTHSWDGKFRRPDL
FT                   LWTPDFNVPMQDNLLWVYEGQTQFWGYVLGARSGLFSKQETLDAYAHIAAKLDTARGRE
FT                   WRPMEDTTHDPIISARRPKGWSSWQRSEDYYNEGLMIWLEADAIIRQQTSGAKGLDDFA
FT                   RAFFGTHPGDWGQVVYNRGDVIRTLNQVAPYDWAGFFQKYVDGTTKETPKGGFTLGGYR
FT                   LVYGDTPGAITKAAEGSGKFTDQSFGIGLIVKNDGEISNVVWDSPAFKAGLAIGSKIVA
FT                   INGDEYSGDVFKAAIKSGKPLQIILKQDKYYRTLSLAYSGGLRYPRLEKMGEGEGSLDR
FT                   LLKPKT"
     atgttcatga tccgcagcct tgctgccgcc cttttccttt ccacggccat ttcgggaccg        60
     ctgatcgcgc aggacgcgat ccggtccagg cccgtcgcgc tgccggtcga caatgccgcg       120
     cccaccccca aggatgtccc ctatcccggc ggcaccatca ggctggaggt cgacgccacc       180
     gacacggtgc agcgcatctt ccgcgtgaag gagaccattc cggtcgccgc cgccgggccg       240
     atgacgctgc tgatgccgca atggctgccg ggcaatcacg cgccgcgggg gcagatcgag       300
     aagctgaccg gcctgacctt caccgcagac ggcaagccgc tggcgtggaa gcgcgatccg       360
     ctgaacgtct ttggcttcgt gatcgacgtg ccgcaggggg tgaagcaggt cgtcgcatcc       420
     ttccagttcc tgtccgccac ccagcccaat cagggccgcg tggtggtgac gcccaagatg       480
     ctgaacatcc agtgggagtc ggtgtcgctc tatccggcgg gctattatac gagggcgatc       540
     ccgatccagg cgaccgtgac ctatcccgac ggctggcagg cagcgacggc gctgcgcggc       600
     aagaagacgg gctctaccgt cgcctatgag acgatcgatt atgaggcgtt gcaggattcg       660
     ccggttttcg cggggctgta tttcaagccg gtcgatctgg ggcataatgt gacgctcaac       720
     atcctggccg acgatgccgg cgaactggac gccaagccgg accagatcgc gaagcacaag       780
     aagctggtcg acgaggcggg cgcgctgttc ggcgcctatc atttcgacca ttatgacttc       840
     ctgttcgcca tcaccgacga gatgggcggc atcgggctgg agcatcatcg ttcttcggaa       900
     aatcaggtcg agccgggcta tttcaagaaa tggggcgatg gcgccgcgct gctggaccgc       960
     aacctgctgc cgcatgaatt cacccatagt tgggacggca agttccgccg tcccgacctg      1020
     ctgtggacgc cggatttcaa cgtgccgatg caggataatc tgctgtgggt ctatgaagga      1080
     caaacgcagt tctggggcta tgtcctgggc gcgcggtccg ggctgttctc caagcaggag      1140
     acgctggacg cctatgccca tatcgcggcc aagctggaca cggcgcgggg gcgcgaatgg      1200
     cggccgatgg aggacaccac ccatgatccc atcatctccg cccggcggcc caagggctgg      1260
     tcgagctggc agcggtcgga ggattattat aatgaagggc tgatgatctg gctggaggcg      1320
     gacgccatca tccgccagca gacaagcggc gccaagggcc tcgacgattt cgccagggcg      1380
     ttcttcggca cccatccggg cgactgggga caggtcgtct ataatcgcgg cgacgtgatc      1440
     aggacgctga accaggtcgc gccctatgac tgggcaggct tcttccagaa atatgtcgac      1500
     ggcacgacga aggagacgcc caagggcggc ttcacgctgg gcggctacag gctggtctat      1560
     ggcgatacgc cgggcgccat caccaaggcg gccgaggggt caggcaagtt caccgaccag      1620
     agcttcggca tcggcctcat cgtcaagaat gacggcgaga tcagcaatgt cgtctgggac      1680
     agcccggcct tcaaggcggg tcttgccatc ggctcgaaga tcgtcgcgat caatggcgac      1740
     gaatattcgg gcgacgtgtt caaggcggcg atcaagtccg gaaagccgct ccagatcata      1800
     ctaaagcagg acaaatatta tcgcactttg agcctcgctt attccggcgg cctgcgctat      1860
     ccgcgcctcg aaaaaatggg agagggtgaa ggcagcctgg accggctgct gaaaccgaaa      1920
     acataa                                                                 1926
//

If you have problems or comments...

PBIL Back to PBIL home page