(data stored in ACNUC7421 zone)

EMBL: AP010803.PE610

AP010803.PE610       Location/Qualifiers
FT   CDS_pept        624973..626331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06100"
FT                   /product="HlyD-family secretion protein"
FT                   /note="type I secrection membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95444"
FT                   /db_xref="GOA:D4YYL2"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL2"
FT                   /protein_id="BAI95444.1"
FT                   /translation="MSQQIVLPALRPEVDLAVIADPKRDIRQGLIIAILFFAGFLGWTA
FT                   FSRLDAAAYATGRLIVAGQRQSVQHRDGGVVGSIHVREGQRVERGRLLMTLAAAEVQAQ
FT                   ERALASQAIRLLAQRARLEAEQMGLSQINEPQEFLSLQPRDRADAALAMKLQRAELQAR
FT                   VAVLAAQRDALQQQVVQSGEQGRGYNEQAVSTREQLRLIDEQIAALRPVAEKGFVSKTR
FT                   MRELERMRASLEGQRGQYNASVAQTRGAVRENEIQVLEAERSFRERTASELRDVELRLG
FT                   DVLPKWRAARDQLARTEIRAPATGAIVGLTVFTPGGVISPGQKLMDIIPERQPLRIQMQ
FT                   ISPDDADDLQMGQKLLVKFSGLHERTLPNLEGELTRLSADSFIDERSGQSYFTGEAAVP
FT                   LSQLQLIRKVRGEDFALRAGMPVQVLIPLRKRSALDYALEPLIGSFWSSFREH"
     atgagccaac agattgtctt gcccgcactg cgcccagagg tagatctggc cgtcatcgcc        60
     gatcccaaac gggatatccg gcaaggcctt attatcgcca tcctcttctt tgcgggtttt       120
     ctgggttgga ccgcgttcag ccggctagat gcggcggcct atgccacagg ccgccttatc       180
     gtcgcgggcc agcgccagtc cgttcagcat cgggatggcg gggtggtcgg cagcatccat       240
     gtcagggaag ggcagcgggt ggagcggggt cgcctgctca tgacactggc ggcggccgag       300
     gtccaagcac aggaacgggc gctggcttcc caggccattc ggcttctggc gcaacgtgcc       360
     cgattggaag ccgagcaaat gggcctttcc caaattaacg aaccgcaaga atttttgtcg       420
     ctacagccta gggatagagc cgatgcggct ctggccatga aactgcaaag ggccgagttg       480
     caagcccgcg tagcggttct ggcggcgcaa cgcgatgcgc tgcaacagca ggtcgtgcaa       540
     tccggggagc aaggccgggg atataacgaa caagctgttt caacccgtga gcaacttcgc       600
     ctgatcgacg aacagatagc tgcgctcaga ccagtcgctg aaaaaggttt tgtctccaag       660
     acacgcatgc gagaactgga gcggatgcgg gcatccctcg aaggacagcg cggccaatat       720
     aacgccagcg tcgctcagac acgcggcgcg gtgcgggaga atgaaataca ggttctggaa       780
     gccgaacgca gcttccgtga acgcaccgcg tcggaattgc gtgacgtcga actgcggctg       840
     ggcgatgtcc ttcccaagtg gcgcgccgcg cgcgaccaac tcgcgcgcac ggagatccgt       900
     gcccctgcta ccggagctat tgtgggactg actgttttta ctcccggcgg cgtcatatcg       960
     ccggggcaaa agctcatgga tattataccg gaacgacagc cactccgcat tcagatgcag      1020
     atttcaccgg atgacgctga cgatctgcag atggggcaaa agctgctggt caaattttcc      1080
     ggattgcatg agcggacctt acccaatctg gaaggcgagc tgacacgttt gtcggccgac      1140
     agctttatcg atgagcgcag cggccaaagc tatttcacag gggaggcagc ggtgccgtta      1200
     agccagttgc agctcatccg gaaagtgcgc ggagaggatt tcgccctgcg ggctgggatg      1260
     ccggttcagg tgctcattcc tctccgcaag cgcagcgccc tagattacgc gcttgaaccg      1320
     ctgattggca gtttctggtc ttcgttcagg gaacattga                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page