(data stored in ACNUC7421 zone)

EMBL: AP010803.PE611

AP010803.PE611       Location/Qualifiers
FT   CDS_pept        complement(626744..627286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06110"
FT                   /product="invertase/recombinase like protein"
FT                   /note="site-specific recombinase, DNA invertase Pin
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95445"
FT                   /db_xref="GOA:D4YYL3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL3"
FT                   /protein_id="BAI95445.1"
FT                   /translation="MIVGYARVSTTDQCLAVQMDELAAHGCDRIFQDQASGTSRARAGL
FT                   VEMMQFVREGDTIVVSRLDRFARSLTDLFQLLDELSRKGVAFQCVHQSIDTSSSTGKLT
FT                   LAILGAVAEFENDIRRERQRAGIAKAKANGVYKGRRAKINAERVREMAAQGFTASTIAS
FT                   ELGCHRQSAYRLLRTAS"
     atgatcgtcg gctatgcgcg tgtcagcacc acggaccaat gccttgctgt ccagatggat        60
     gaacttgctg cccacggctg tgaccgcatc tttcaggatc aggccagcgg caccagcagg       120
     gcacgcgcag ggctggtgga aatgatgcag tttgtccgcg agggcgacac catcgtggtc       180
     agcaggcttg accgcttcgc tcgctcgctg actgacctgt ttcagctatt agacgaactc       240
     agccgcaagg gcgttgcctt ccaatgcgtc catcagtcca tcgacaccag tagcagcacg       300
     ggcaagctga cactcgcgat cttgggcgca gtggcggaat tcgagaacga tatccgtagg       360
     gaacggcagc gggctggcat cgcaaaggct aaggccaatg gcgtctataa agggcgcagg       420
     gctaagatta acgccgagcg ggtcagggaa atggccgctc aaggctttac agctagcacg       480
     atcgccagcg aacttgggtg ccacaggcaa tccgcttatc ggctcttgcg taccgcgtcc       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page