(data stored in ACNUC7421 zone)

EMBL: AP010803.PE612

AP010803.PE612       Location/Qualifiers
FT   CDS_pept        627443..628906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06120"
FT                   /product="hypothetical protein"
FT                   /note="putative GTPase or GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95446"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL4"
FT                   /protein_id="BAI95446.1"
FT                   /translation="MNLTLHGRLRQKLRCCPDGGGIGRKRRPSRKAGRTRQSGASVLNF
FT                   QNLAGCVFLFLVPVLCSLHCSQGDGVEKQTIGAWVVHHGRKVAADMRGAAEFSAIDLAA
FT                   KSAGLLARLGESDEATLTSDQVIAAAKVGNLNPKTELTACLDHLQKRKLIDRSASGDVS
FT                   VLGVSGSSALTHAADLFEDNDPHPTERAAITLAELASQAPVTANGAIEFLGDTHKLAKA
FT                   DATDFVLQASQIGFVDAEGEGADKLLFNGNLFRRDTASKAKKVIDSLSSAEQAKIVEFD
FT                   AKLKLRGAVTAATAIKILGEPLFAKVRAAALYDMNIVSNEAGDHVFITSPGSFHKFSNP
FT                   LTEDAFDHAKALVAALTYGMTHSPSARGQIWGIDLLLGKLIRGGSVGPATAIGNDYRAL
FT                   ELERVVQTERSGYGFKMRLLKREVGVIALEVLKGRNAAAAALETLPSAGMRSYTPPEAA
FT                   RVGLRKGQSAASRAQTRSLLSAVRGGGSL"
     atgaacctga ctcttcacgg ccgattgcgg caaaagctgc gctgttgccc cgatgggggg        60
     ggcattggcc gcaagcgtcg gccttcgcgt aaggctggaa gaacgaggca gagcggcgca       120
     tctgtgctga attttcaaaa tcttgctggc tgcgtatttc ttttcctcgt tccagtccta       180
     tgttctcttc attgctcgca gggggatggt gtggagaagc aaactatcgg cgcttgggtc       240
     gttcaccacg gccgcaaggt tgcggctgat atgcgcgggg ccgctgaatt tagcgcgatc       300
     gatctggcag cgaagtccgc tgggctcttg gctcgcttgg gggagagcga tgaagccacc       360
     ttaacttcgg accaggtcat cgcggctgca aaggttggaa acctcaatcc gaaaactgag       420
     ctcacagctt gcttagatca cttgcagaag cgtaaactta tcgaccgttc ggcttctggc       480
     gatgtgtccg tgttgggcgt gagcggatcc tcggcgctaa cccacgctgc ggatcttttt       540
     gaagacaacg acccccatcc caccgaacgc gctgccatta ctttagccga actggcctcg       600
     caggccccag tcacggcgaa tggtgcaatt gaatttctcg gtgataccca caagctcgcc       660
     aaagcggacg ctaccgattt tgttctgcag gcttcccaga tcggctttgt cgatgcggaa       720
     ggggaagggg cagacaaact cttgttcaat ggcaacctct ttcgtcggga caccgctagc       780
     aaagccaaaa aggttatcga ttcgctcagt tccgccgaac aggcaaagat tgtcgaattc       840
     gatgcaaaat taaaattgcg cggagccgta acagccgcaa ctgcgataaa aattcttggc       900
     gagcccttgt ttgccaaagt acgggcagca gccctgtacg acatgaacat agtttccaat       960
     gaagccggtg atcatgtttt cataacttcg ccgggatcat tccataaatt cagcaatccc      1020
     ctgacggaag atgcttttga tcacgcaaaa gcgctggtgg cagccctgac atatggaatg      1080
     actcacagcc catcagcacg cggacagata tgggggatcg atcttctgct cggaaagctg      1140
     atacgaggcg gttccgtggg accagccacg gccattggca atgactacag agcacttgaa      1200
     ctcgagcgcg tagtgcaaac cgaacgctcc ggttacgggt tcaaaatgcg cctgttgaaa      1260
     cgcgaagtcg gggtaattgc tttggaagtg ctaaaaggca gaaatgccgc cgccgccgct      1320
     ctggaaacct tacccagcgc cggaatgcga agctataccc caccagaggc cgcgcgcgtt      1380
     ggcctgcgaa agggccagtc tgctgcgagc cgagcgcaga cccgttcgct gttgagcgca      1440
     gttcgtggcg gaggctcgct gtga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page