(data stored in ACNUC7421 zone)

EMBL: AP010803.PE613

AP010803.PE613       Location/Qualifiers
FT   CDS_pept        628903..630078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95447"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL5"
FT                   /protein_id="BAI95447.1"
FT                   /translation="MNAKPTSAPKKTGKKGFETEEIVRSYFLGAGFFVVRGVKLRHGGD
FT                   ELTDIDLWLYERSATLARRRIIIDIKDNAQPKAAERLFFVKGLAELIQVEATGIATSDS
FT                   RRSLRELARKHNVLWIDNADLQRLKSSQRLTASSRLSDEDLGELIAKVDASRSSKDVRD
FT                   TFASVKSSVADRFGPSCANTAADGAQYFARMCVEAHPNSLPAQVFTRLTYFCAGIAAAA
FT                   FDFASGESALRPQQERLASLTDAIRFGDDPKGTAEKLRWAQAAIRDYAPNGAGLADIIH
FT                   NRFHQALQSVPAESLAEIVVKMANSDRLFNAAKDLEQAAFLIDCPEFDELPIDARAFLG
FT                   AMLDFITIDRITFSQGWTPPKPVISAPAATEDANPTTSEATHPPTEDGKLL"
     gtgaacgcca agccaaccag tgctcccaaa aagaccggga aaaagggctt cgagacggag        60
     gagattgtac ggtcttactt cctgggggca ggatttttcg tagttcgtgg tgtgaagcta       120
     cgacatggcg gcgatgaact gactgacatt gacctctggc tctacgaacg atcggcgaca       180
     ctcgcacgtc gccggattat catagacatc aaggataatg cgcagcctaa ggcggccgag       240
     cgtctctttt ttgtgaaggg tctggctgag ttaatccaag tcgaagcgac cgggattgca       300
     accagcgact cgcgtcgttc tctgcgggag ctcgcccgga agcacaatgt tctgtggatc       360
     gacaacgccg atctgcaaag attgaaatcg agccagcgtc ttacggcttc ctcgcgcctc       420
     tctgacgaag atttgggtga acttattgcc aaggttgatg catcgcgctc ttcgaaggat       480
     gtccgcgaca ccttcgcctc ggtaaaatct tcagtggccg atcggttcgg accatcttgc       540
     gcaaacaccg cagcggatgg cgcgcaatat tttgcgcgaa tgtgtgtcga agcacatccc       600
     aactcacttc ccgcgcaggt ttttactcgc ctaacgtatt tttgcgcggg tatcgctgcc       660
     gccgcgtttg actttgcctc aggggaatcc gcgctgcgtc ctcagcagga gcgactggct       720
     agcttgaccg acgctatccg ctttggtgac gatccaaaag ggacggcaga aaagcttcgt       780
     tgggcacaag ccgccataag ggattacgcc cctaatggcg ctggccttgc cgacataatt       840
     cacaatcggt tccatcaagc acttcagtca gttccggctg agagcctcgc tgaaatcgta       900
     gtaaaaatgg cgaactctga tcgcctcttc aatgccgcga aagatttaga acaggctgca       960
     tttttgatcg attgtccaga atttgatgaa ctgcctatcg atgccagggc ctttttggga      1020
     gcaatgctgg actttatcac aattgatcgg attacttttt ctcagggttg gaccccacct      1080
     aagcctgtta taagcgctcc cgctgccact gaagatgcaa atccaacgac ttccgaggca      1140
     actcacccgc cgactgagga cggcaaattg ttatga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page