(data stored in ACNUC7421 zone)

EMBL: AP010803.PE616

AP010803.PE616       Location/Qualifiers
FT   CDS_pept        633186..633827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95450"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL8"
FT                   /protein_id="BAI95450.1"
FT                   /translation="MSDVSELLLVQRFDADRGWFDFEVEKQDDGSEVHYAAKRFGLLRD
FT                   DVSTGMDQLPAERILELIAAFKQKSLVADNEAQTKLRVAGRQILYQQLAEAYAFGLACF
FT                   SSIYNREHLTTVLSQHDLGKQAKALTSTGSYNKWNAITALLYGRWVNTDTDAPIADGEH
FT                   EGIANRAYRRDRSAEKYGCVLATLEGSKVSRPLTKSAVADSVRQWDCLAG"
     atgtctgatg taagtgagtt gctgctcgtg cagcgttttg atgctgatcg cgggtggttc        60
     gattttgaag ttgagaagca ggatgacggc tctgaggtcc actatgccgc caagcgtttt       120
     gggctgctcc gcgatgacgt ttctactggc atggaccagt tgccggccga gcgcattctg       180
     gaactgattg ctgccttcaa gcagaagtca cttgtcgccg ataacgaggc ccagacgaag       240
     ctcagggtcg ctggtcgcca aatcctctac cagcagcttg cggaagccta tgcctttggc       300
     cttgcctgct tttcgtcgat ctacaatcgc gaacatttga cgaccgtttt gtcgcagcac       360
     gatctgggca agcaggcgaa ggctctcaca tcgaccggca gttataacaa atggaatgcc       420
     atcacggcgc tgctctacgg gcgttgggtc aataccgaca ccgacgcccc catcgccgat       480
     ggggagcatg aaggcattgc caatcgcgca taccggcgtg atcgttccgc cgagaaatat       540
     ggctgcgtcc ttgccactct ggaaggcagc aaggttagca ggccgttgac gaagtcggcg       600
     gtggctgatt cagtgcggca gtgggattgt ctggcgggtt ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page