(data stored in ACNUC7421 zone)

EMBL: AP010803.PE618

AP010803.PE618       Location/Qualifiers
FT   CDS_pept        635238..635843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95452"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM0"
FT                   /protein_id="BAI95452.1"
FT                   /translation="MDFITTAKFKSSEDGKVYGGILALEMHYRQWAAKQAAKRAKKPTP
FT                   RQIARRQQDRANAVAKAENPANDDVFEFAKPAQLSEAVEFGRIIFKVLGDKLFVVGVDG
FT                   WEQAKYDEFVIAKGRKILAREAEIQAGIDAKREGVKESAGAVLVNLRYDEDFSDLLADG
FT                   ADVEEVTAAFKATVADMKAKRLQKQTEHLEQFADPIPD"
     gtggatttca ttaccacggc aaaattcaag tcctcggagg acggcaaggt ctatggcggc        60
     attctggcgc tggagatgca ctataggcaa tgggcggcca agcaggcggc gaagcgagcc       120
     aaaaagccta cgccacggca aattgcacgg cgtcagcagg atcgcgccaa tgctgtcgcc       180
     aaggcggaaa accccgccaa cgacgatgtg tttgaatttg ccaagcctgc ccaactttca       240
     gaagccgttg agtttggccg cataatcttc aaagtgctcg gcgataagct gttcgttgtc       300
     ggcgtggatg gctgggaaca ggccaaatac gatgagtttg tcattgcgaa gggcaggaaa       360
     attctagccc gcgaagctga aattcaggcc gggatcgatg ccaagcggga aggagtgaaa       420
     gagagcgcag gcgcagtgtt ggtcaatcta cgctacgatg aggatttctc cgatttgctg       480
     gcagatgggg ccgatgttga ggaggtgacc gccgccttca aagcgaccgt ggctgacatg       540
     aaggcaaagc gactgcaaaa gcaaactgag catcttgagc agtttgccga tccaatcccc       600
     gactaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page