(data stored in ACNUC7421 zone)

EMBL: AP010803.PE620

AP010803.PE620       Location/Qualifiers
FT   CDS_pept        complement(636140..636382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95454"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM2"
FT                   /protein_id="BAI95454.1"
FT                   /translation="MSQRYKYGMRFYEFATTKPKKPRKPQKPMTPAQSMVAAKKRQVEL
FT                   AKQALQSVKDQQKRRKEAERTRQISYIEPLPKSAS"
     atgtcgcaga gatataaata cggcatgaga ttttacgaat tcgccacgac caaacccaag        60
     aagccgcgca aaccccaaaa gcctatgact cccgcgcaat ccatggtggc agcgaaaaag       120
     cgtcaggtcg aattggccaa gcaggccctt caatcggtga aggatcagca gaagcgtagg       180
     aaagaggctg aacgcactcg ccagatttcc tacattgagc cccttcccaa atcggcatcc       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page