(data stored in ACNUC7421 zone)

EMBL: AP010803.PE621

AP010803.PE621       Location/Qualifiers
FT   CDS_pept        complement(636641..637831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06210"
FT                   /product="peptidase M23B"
FT                   /EC_number="3.4.24.75"
FT                   /note="membrane protein related to metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95455"
FT                   /db_xref="GOA:D4YYM3"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYM3"
FT                   /protein_id="BAI95455.1"
FT                   /translation="MGAAALWAGMTARCSKLCPDREIFLRSGGQVKFIHISRRAQLAAA
FT                   GLLSSALVGGIGFGLSVAASSAEIEQERAALAARDKAVSSSASQVARYRKSVDQLAQEL
FT                   QERQDFMDDLYRTHFGQDGTAPAGDVVGKADGGTKGGTSKLDTKISVAPEAAPLLRIDA
FT                   RQRRFAALLTGAVQKRADKAAAAIRSFGLNPDSLARSAARAQNRAMGGPFVPWEGQDVL
FT                   PGEFEKLAKALSRMEFLEASLLAIPSGKPTATPMMSSSYGYRSDPFNGHAAFHAGLDFP
FT                   GSMGQPILAAASGKVSFVGQRSGYGNVVEVTHGNGILTRYAHLSGFSARVGQQVARGGA
FT                   IARMGSTGRSTGPHLHFEVRVNGNAINPRRFLEARKDVLQIQQIATARLADVGDRG"
     atgggggcag ccgccctctg ggccggcatg acggcccggt gttcgaagct gtgcccggat        60
     cgggagattt tcctgcgctc cggcggccag gtgaagttca tccatatctc gcgcagggcg       120
     cagcttgccg cggccggcct gctctcttcc gccctggtcg gcgggattgg attcggcctg       180
     tccgtggccg ccagcagcgc tgagatcgag caggagcgcg ccgctctcgc cgcccgggac       240
     aaggccgtct ccagcagcgc cagccaggtc gcgcgctatc gcaagtcggt cgaccagctc       300
     gcgcaggagc tgcaggagcg ccaggacttc atggacgacc tttaccgcac gcatttcggc       360
     caggacggca cggcccccgc cggcgatgtg gtcggcaagg ccgatggcgg aaccaagggc       420
     ggcacgtcca agctcgacac caagatcagc gttgcgccgg aagcggcgcc gctgctgcgg       480
     atcgacgccc ggcagcgccg cttcgccgcc ctgctgaccg gcgccgtcca gaagcgcgcc       540
     gacaaggcgg ccgccgcgat ccgcagcttc ggcctcaatc ccgacagcct cgcccgcagc       600
     gccgcccgcg cgcaaaaccg ggcgatgggc ggccccttcg tgccctggga aggacaggac       660
     gtcctgccgg gcgagttcga aaagctcgcc aaggcgctgt cccgcatgga attcctggaa       720
     gcgagcctgc tcgccatccc ttccggcaag ccgacggcga cgccgatgat gagcagcagc       780
     tatggctatc gcagcgatcc gttcaacggc catgcggcct tccacgcggg cctggatttt       840
     ccgggtagca tgggccagcc gatcctggcc gccgcatcgg gcaaggtcag tttcgtcggc       900
     cagcgcagcg gctatggcaa tgtggtcgag gtcacgcatg gcaacggcat cctgacccgc       960
     tacgcccatc tgtccggctt cagcgcgcgg gtcggccaac aggtggcgcg cggcggcgcc      1020
     attgcgcgca tgggatcgac cggccgctcc acggggccgc atcttcattt cgaggtgcgg      1080
     gtgaacggca atgccatcaa tccccgccgc ttcctggagg cgcgcaagga tgtcctccaa      1140
     atccagcaaa tcgcgacggc gcgtctcgcc gatgtcggcg accggggata g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page