(data stored in ACNUC7421 zone)

EMBL: AP010803.PE649

AP010803.PE649       Location/Qualifiers
FT   CDS_pept        655381..655935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95483"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ1"
FT                   /protein_id="BAI95483.1"
FT                   /translation="MRKIVALGWAGAAMAAPAHSAVTASSDAGFAVENSVQVAADAATV
FT                   YRLLGQPGRWWNGAHSYSGSAANLRLEPVAGGCFCEALPGEEGRVGSVEHARVIHAAPD
FT                   RQLRLSGALGPLQAEAVTGTLTFDIAPSGKGVRVVMSYVVGGYIRMGAARIAPVVDKVL
FT                   AEQLAGLKRVAEQDAAGRTGL"
     atgcgcaaga tcgtggcttt gggatgggct ggcgcggcga tggccgcacc ggcccattct        60
     gctgttaccg ccagcagcga tgccggcttt gcggtggaga acagcgttca ggtcgccgcc       120
     gatgccgcga cggtctatcg ccttctgggc cagcccggac gctggtggaa cggtgcgcat       180
     agctatagcg gctctgccgc caatctcagg ctggaaccag tggcgggcgg atgcttctgc       240
     gaagcattgc cgggcgaaga gggacgggtg ggcagcgtcg aacatgcccg cgtgatccat       300
     gccgcgcctg accggcaatt gcggctgtcc ggcgcccttg ggccgttgca ggccgaagcc       360
     gtgaccggga cgctgacttt cgacatcgcc ccgtccggga agggcgtgcg tgtcgtcatg       420
     agctatgtgg tcggcggtta tatccgcatg ggtgcggcca ggatcgcgcc ggtggtggac       480
     aaggtgctgg cggagcaact ggcgggattg aaacgggtgg cggagcagga tgccgctggc       540
     cgaaccggcc tgtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page