(data stored in SCRATCH zone)

EMBL: AP010803.PE65

AP010803.PE65        Location/Qualifiers
FT   CDS_pept        63978..64112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94899"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX17"
FT                   /protein_id="BAI94899.1"
FT                   /translation="MGVAEKRPFSRSFKVTTALLRRRLWQVKGIGRSLGPCPAEPYPA"
     gtgggcgtag ccgagaaaag gccgttttcc cgctccttca aagtcacgac ggcgctgctg        60
     cgcaggcgcc tctggcaggt caagggcata ggccgatcgc tcggtccctg cccggcggag       120
     ccttatccgg cctga                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page