(data stored in ACNUC7421 zone)

EMBL: AP010803.PE651

AP010803.PE651       Location/Qualifiers
FT   CDS_pept        657358..657903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06510"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein with a bacterial SH3 domain
FT                   homologue / glycine rich secreted protein grsp-2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95485"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ3"
FT                   /protein_id="BAI95485.1"
FT                   /translation="MAWTGRRFLAAIGLAGALALGGCAYDDGYYGGVSVGSGYYRPGYY
FT                   GGWYDGYYYPGSGYYVYNRSGHRQRWSEGQRRYWEGRREARRDDGRRGNWNNGAPRQGW
FT                   RERSGGDGNRWSGNWRNARQGNPAAGAQAPRPGRGQGDMTTPRTERNWGTPRTRSDGGA
FT                   RSGGGGRSGREGWRGRRD"
     atggcctgga ccggacggag gttcctcgcg gcgatcggcc ttgccggtgc gctggccctg        60
     ggcggctgtg cttatgatga tggctattat ggcggcgtga gcgtgggcag cggctattat       120
     cgtcccggct attatggcgg ctggtatgac ggctactact atcccggcag cggctattat       180
     gtgtacaatc gcagcggcca tcgccaacgt tggagcgaag gccagcgccg ctattgggaa       240
     ggacgccggg aggcccgccg cgatgacggc cggcgcggca actggaacaa tggcgcaccg       300
     cgtcagggct ggcgggagcg ttccggcggc gacggcaatc ggtggagcgg caattggcgg       360
     aacgcccgac agggcaatcc cgctgcgggc gcgcaggcgc cccggccagg aaggggacaa       420
     ggggatatga cgacgccacg gacggaacgc aattggggga cgccgcgcac ccgatccgac       480
     ggcggcgcgc gttccggcgg cggcggccgc tccggccgtg agggctggcg gggtcggcgc       540
     gactga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page