(data stored in ACNUC7421 zone)

EMBL: AP010803.PE655

AP010803.PE655       Location/Qualifiers
FT   CDS_pept        660606..661004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06550"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95489"
FT                   /db_xref="InterPro:IPR008320"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ7"
FT                   /protein_id="BAI95489.1"
FT                   /translation="MPLHLTKIAFRSESPATLRAWLESHAEEARLTTRYLPKRVEELAD
FT                   GSLFWIHGHQLVGRSPLLGFQETGQGRYWIRLEPRLIPVRALPKRAHQGWRYLEDKDAP
FT                   PDLGSGEANDLDAMPTRLLGELSKLGLL"
     atgccgctgc acctcaccaa gatcgccttt cggagcgaaa gtcccgcgac gctccgcgcc        60
     tggctggaaa gccatgcgga ggaggcgcgg ctgaccacgc gctacctgcc aaagcgggtc       120
     gaggaactgg cggatggttc gctgttctgg attcatgggc accagcttgt cgggcgcagt       180
     ccattgctgg gctttcagga aaccgggcag ggccgttact ggatcaggct ggaaccccgg       240
     ctgatcccgg tgcgcgcatt gcccaagcgg gcgcatcagg gctggcgcta tctggaggac       300
     aaggacgcgc cgcctgatct ggggtcgggc gaagcgaacg atctggacgc catgccgacg       360
     cggttgctgg gggaattgtc gaagctgggg ttattgtag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page