(data stored in ACNUC7421 zone)

EMBL: AP010803.PE657

AP010803.PE657       Location/Qualifiers
FT   CDS_pept        complement(662421..662885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95491"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ9"
FT                   /protein_id="BAI95491.1"
FT                   /translation="MADASIFDRLKQDHDAHRQLFDKMADAQAEPDRLEKLFEQFRVEV
FT                   TAHAAAEEETLYATMLARPDLREDAQHSVSEHKEIDDYLEELEGLPFNGDEWNRVFAQM
FT                   KKRYLHHIEEEEEEMFPDAAKELTAEEEQKLAARFAQRKPAELQRAEAND"
     atggccgacg ccagcatttt cgaccgattg aagcaggatc atgacgccca tcggcaattg        60
     ttcgacaaga tggccgatgc gcaggcggag ccggatcggc tggaaaagct gttcgaacag       120
     ttccgggtgg aggtgacggc ccatgcggcg gcggaggagg aaacgctcta cgccaccatg       180
     ctggcgcggc ccgacctgcg cgaagacgcg cagcacagcg tgtcggagca taaggagatc       240
     gacgattatc ttgaggaact ggaaggcctg cccttcaatg gcgatgaatg gaaccgcgtc       300
     ttcgcccaga tgaagaagcg ctacctccat catatcgagg aggaggagga ggagatgttc       360
     cccgacgcgg cgaaggaact gaccgcggag gaggagcaga agctggccgc gcggttcgcc       420
     cagcgcaaac cggccgaatt gcagcgcgcc gaggcgaatg attag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page