(data stored in ACNUC7421 zone)

EMBL: AP010803.PE658

AP010803.PE658       Location/Qualifiers
FT   CDS_pept        complement(662939..663352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95492"
FT                   /db_xref="GOA:D4YYR0"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYR0"
FT                   /protein_id="BAI95492.1"
FT                   /translation="MPLIGRAVHVFLVQRKERAGFLATKWNDGATRRTGHAQRMSTHLA
FT                   VALVVFCLLQIFIVAKMGGSLLLHLGIIVAIGGFAVAARGLERRWELLDSSGLPAHSLD
FT                   LRFRRDLVQLWGASIGGGLLWIPVAIIFHALFG"
     ttgccgttga tcggacgggc ggttcatgtt ttccttgtcc aacgcaagga aagggccgga        60
     tttttggcga cgaagtggaa cgatggcgcg acccgccgca cgggccatgc ccagcggatg       120
     agcacccatc tggccgtcgc cctggtcgtc ttctgcctgc ttcagatctt catcgtcgcc       180
     aagatgggcg ggtcgctgct gctgcatctg ggcatcatcg tggcgatcgg cggctttgcc       240
     gtcgcggcgc gggggctgga gcgccgctgg gagttgctcg acagcagcgg cctgcccgcg       300
     cacagcctcg accttcgctt ccgccgcgat ctggtgcagc tctggggcgc cagcattggc       360
     ggcgggctgc tctggattcc cgtcgcgatc atttttcacg ccctgttcgg ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page