(data stored in ACNUC7421 zone)

EMBL: AP010803.PE659

AP010803.PE659       Location/Qualifiers
FT   CDS_pept        complement(663365..664612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06590"
FT                   /product="radical SAM protein"
FT                   /note="molybdenum cofactor biosynthesis enzyme / putative
FT                   DNA-binding protein with the helix-hairpin-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95493"
FT                   /db_xref="GOA:D4YYR1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYR1"
FT                   /protein_id="BAI95493.1"
FT                   /translation="MTALTTRQKLEILADAAKYDASCASSGTAKRDSASGRKGGIGSTE
FT                   GMGICHAYAPDGRCISLLKILLTNSCVFDCHYCVNRRSSDVRRARFTVREVVDLTLSFY
FT                   RRNYIEGLFLSSGIIRSSDYTMEQLVAVARSLREEHDFRGYIHLKTIPDADPELARQAG
FT                   LYADRLSINVELPTEQGLRRLAPEKDGQRIESAMAGMRDAIEDGSDASRRYAHAPRFAP
FT                   AGQSTQMIVGADQADDRAIIRRASALYSRHGLRRVYYSAFSPIPSPSSVLPLKRPPLMR
FT                   EHRLYQSDWMMRFYGYSAQELESAADPATGCLPLDIDPKLAWALRHRDCFPVDVNRAPR
FT                   EALLRVPGLGVKAVDRIVASRRHRRLRLDDVARLTRSVAKLRPFLVAADWRPVHLADRL
FT                   TLHIAHPPASQYELFP"
     atgaccgccc tcaccacccg acagaagctg gaaatcctgg ccgacgccgc caaatatgac        60
     gcgtcctgcg cctcgtcggg cacggcgaag cgcgacagcg cctcgggccg gaagggcggc       120
     atcggctcga ccgagggcat gggcatatgc catgcctatg cgcccgacgg ccgctgcatt       180
     tcgctgctca agatcctgct gaccaacagc tgcgtcttcg actgccatta ttgcgtcaac       240
     cgccggtcga gcgatgtgcg gcgcgcccgc ttcaccgtgc gggaagtggt cgacctgacg       300
     ctcagcttct atcgccgcaa ctatattgag gggctgttcc tctcctccgg catcatccgg       360
     tcgtccgact acacgatgga acagttggtg gccgtcgccc gcagcctgcg cgaggagcat       420
     gattttcgcg gctatatcca cctcaagacc attcccgacg ccgatccgga actggcgcgc       480
     caggcgggcc tttatgccga ccggctgtcg atcaacgtcg aactgccgac cgagcagggc       540
     ctgcgcaggc tggcgccgga gaaggacggg cagcggatcg aaagcgccat ggcgggcatg       600
     cgcgacgcca tagaggatgg gtcggacgcc agtcgccgct acgcccatgc gccgcgcttc       660
     gccccggccg gccagtccac ccagatgatc gtcggcgcgg accaggcgga cgaccgcgcc       720
     atcatccggc gggccagtgc gctctacagc cggcacgggc tgcggcgggt ctattacagc       780
     gccttctccc ccatcccctc gcccagcagc gtgctgccct tgaagcgtcc gccgctgatg       840
     cgcgaacacc ggctctatca atcggactgg atgatgcgct tctacggcta ttcggcgcag       900
     gagctggaaa gcgccgccga tcccgccacc ggctgcctgc cgctcgacat cgatcccaag       960
     ctcgcctggg cgctgcggca ccgggattgc tttccggtcg acgtcaaccg cgccccgcgc      1020
     gaggcgttgc tgcgggtgcc gggactgggg gtgaaggcgg tggaccggat cgtcgccagc      1080
     cgccgccacc ggcggctgcg gctggacgat gtcgcccggc tgacgcggag cgtcgccaag      1140
     ctgcgcccct tcctggtcgc ggccgactgg cgcccggtgc atctggccga ccggctgacc      1200
     ctgcacatcg cgcacccgcc cgcctcgcaa tatgagcttt ttccgtga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page