(data stored in ACNUC7421 zone)

EMBL: AP010803.PE66

AP010803.PE66        Location/Qualifiers
FT   CDS_pept        64191..64973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94900"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX18"
FT                   /protein_id="BAI94900.1"
FT                   /translation="MINNRQAGRRNRGRNNNNGRPNGGNRGGGDNGNRIDSRARGNAAQ
FT                   LLEKYKNMARDSQMAGDRVNAEYYLQFADHYFRVLADNRARQEEQQQRFRPRDENFDDS
FT                   FDDFDAADEAGEDARADQATDRGQDFDRRRDEQRDYREGRNDRNRRDRNDRNERRRDRP
FT                   SVEEAAGEEVAEHRQAEAASEPVAAVQPAPEAQSEADAPRARRGRPRKAATKEEGQGGL
FT                   DLAVLPPSIARADNDADAAAEAPRKRTRRARPAAEAAE"
     ttgatcaaca acaggcaggc cggtcgccgg aatcgcggcc ggaacaacaa taatggccgg        60
     cccaacggtg gcaatcgggg cggcggcgac aatggcaacc ggatcgacag ccgcgcacgc       120
     ggcaatgcgg cccagcttct tgaaaaatac aagaatatgg cgcgcgattc ccagatggcg       180
     ggcgatcggg tcaatgcgga atattatctg caattcgccg accattattt ccgcgtgctg       240
     gccgacaacc gcgcccggca ggaggagcag cagcagcgct tccgcccacg ggacgagaat       300
     ttcgacgaca gtttcgacga tttcgacgcc gccgacgaag cgggcgagga cgcgcgcgcc       360
     gatcaggcga ccgaccgcgg gcaggatttc gatcgccggc gggacgagca gcgcgactat       420
     cgcgaaggtc ggaacgaccg caaccggcgg gaccgcaatg accgcaacga acggcgccgg       480
     gatcgtcctt cggtagagga agcggcaggc gaggaagtcg cggaacatcg gcaggccgaa       540
     gccgcgtccg agccggttgc cgccgttcag ccggccccgg aagcccagtc cgaggcggat       600
     gccccccgcg cccgccgcgg tcgcccgcgt aaggcggcga cgaaggagga agggcagggc       660
     ggtctggacc tggccgtgct gccgccgtcc atcgcgcgcg ccgacaatga tgcggacgcc       720
     gccgccgaag cgccgcgcaa gcggacccgc cgcgcccggc ccgctgctga agcggccgaa       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page