(data stored in ACNUC7421 zone)

EMBL: AP010803.PE660

AP010803.PE660       Location/Qualifiers
FT   CDS_pept        complement(664659..666530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06600"
FT                   /product="signal transduction histidine kinase"
FT                   /note="two-component system, NtrC family, sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95494"
FT                   /db_xref="GOA:D4YYR2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYR2"
FT                   /protein_id="BAI95494.1"
FT                   /translation="MPAIRPERSIFLLLLALLIVGLAVGSTYWLYAVQQRVNIWVQHTL
FT                   RVENQLSTLLLHVQEAESAQRGFMLTRKDSFLGPYEAFRGRWRQELAALRVEVRDNPPQ
FT                   ARSVEELEELLDDRLFLMRTGIERRRRGEIIPAGDFDAGMVTMARIRALVAAMRAREAQ
FT                   LLKGRTANDNRLSTMVSIGLAVSAVLITLLGAVALRTAYRRVAEATESQQALADINRRL
FT                   MSEAREREAAEGQLRQMQKMESIGQLTGGIAHDFNNMLAIVIGSLDIVRRRLAPGTDVR
FT                   IVRGVDNATEGAQRAAQLTARLLAFSRQQPLDPQPTDVNKLVGGMSELLRRTIGESIRV
FT                   EAVLAGGLWRASIDPSQLESAIINLCVNSRDAMPMGGKLTIETANAHLDDAYAAAHNDV
FT                   LAGQYVMVSVTDSGTGMPPEVVERAFDPFFTTKGVGKGTGLGLSQVFGFIKQSRGHVKI
FT                   YSEPGEGTIIKIYLPRHYGPEPVAGAVQAAPAELPRAKGEEIILVVEDEERVRHMSVDS
FT                   LRELGYTIVQASDGEQALEMLTIQPRIDMLFTDVVMPGINGRDLADRARASRPGLKILY
FT                   TTGYTRNAIVHNGMLDPGVSFLAKPFTLDQLAAKVRQVLDADPGESD"
     atgcccgcca tccgccccga acggtcgatc ttcctgctgc ttctggcctt gctgatcgtc        60
     gggctggcgg tgggcagcac ctattggctc tacgcggtgc agcagcgggt caacatctgg       120
     gtccagcaca ccctgcgcgt cgagaaccag ctttcgacgc tgctgctgca tgtgcaggag       180
     gcggaaagcg cccagcgcgg gttcatgctg acgcgcaagg actccttcct tggtccctat       240
     gaggcatttc gcggccgatg gcggcaggaa ctcgccgcgc tgcgcgtgga ggtgcgcgac       300
     aatcccccgc aggcccgatc ggtggaggaa ctggaggaac tgttggacga ccggctgttc       360
     ctgatgcgca cgggcataga gcggcggcgg cggggggaga tcatcccggc gggcgatttc       420
     gatgcgggca tggtcacgat ggcccgcatc cgcgccctgg tggcggcgat gcgggcgcgg       480
     gaggcgcagt tgctgaaggg ccggacggcc aatgacaatc gcctcagcac catggtttcg       540
     atcgggcttg ccgtgtccgc cgtgctgatc accctgttgg gcgcggtggc gctgcgcacc       600
     gcctatcgcc gcgtggccga ggcgacggaa agccagcagg cgctggccga catcaaccgc       660
     cgcctgatga gcgaggcgcg ggagcgcgaa gccgccgagg ggcaattgcg ccagatgcag       720
     aagatggaat cgatcggcca actgaccggc ggcatcgccc atgacttcaa caatatgctc       780
     gccatcgtca tcggctcgct cgacattgtc cggcggcggc tggcgccggg caccgacgtc       840
     cggatcgtca ggggcgtcga caacgcgacc gaaggggcgc aacgcgctgc ccagctcacc       900
     gcccggctgc tcgccttttc ccgccagcag ccgctggacc cgcagccgac cgacgtcaac       960
     aagctggtcg gcggcatgtc tgaactgctg cgccgcacga tcggcgagag catccgggtg      1020
     gaggccgtgc tggcgggcgg gctgtggcgg gcgagcatcg accccagcca gctcgaatcg      1080
     gccatcatca acctctgcgt caattcgcgc gatgcgatgc ccatgggcgg caagctgacg      1140
     atcgagacgg ccaacgccca tctcgacgat gcctatgccg ccgcccacaa cgacgtcttg      1200
     gccgggcaat atgtgatggt gtcggtcacc gacagcggca ccggcatgcc gcccgaggtg      1260
     gtggagcgcg ccttcgaccc cttcttcacc accaagggcg tgggcaaggg caccggcctc      1320
     ggcctcagcc aggtgttcgg gttcatcaag cagtcgcgcg gccatgtgaa gatctattcc      1380
     gaacccggcg agggcacgat catcaagatc tacctgccgc gccattacgg gccggagccg      1440
     gtcgccggcg ccgtccaggc ggcgcccgcc gaactgcccc gcgccaaggg ggaagagatc      1500
     atcctggtgg tggaggacga ggagcgcgtc cggcacatgt cggtcgattc gctgcgggag      1560
     ctgggctaca ccatcgtcca ggcatccgac ggcgaacagg cgctggaaat gctgacgatc      1620
     cagccgcgca tcgacatgct gttcaccgac gtggtcatgc ccggcatcaa cgggcgcgac      1680
     ctggccgacc gggcgcgggc gagccgaccg ggcctcaaga tcctctacac caccggctat      1740
     acccgcaacg ccatcgtcca taacggcatg ctcgaccccg gcgtctcctt cctcgccaag      1800
     cccttcacgc tcgatcaact ggcggcaaag gtgcgccagg tccttgatgc cgatcccggc      1860
     gagtccgact ga                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page