(data stored in ACNUC7421 zone)

EMBL: AP010803.PE672

AP010803.PE672       Location/Qualifiers
FT   CDS_pept        676488..676619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95506"
FT                   /db_xref="GOA:D4YYS4"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS4"
FT                   /protein_id="BAI95506.1"
FT                   /translation="MTPDEDRQVRTRQKSRAIVTGVLLGALVILFYAITIAKIGGGQ"
     atgactcccg acgaagacag gcaggtccgg acgcggcaga aatcccgcgc catcgtgacg        60
     ggggtgctgc tgggcgcgct ggtcatcctt ttctacgcga tcaccatcgc caagatcggt       120
     gggggacagt ga                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page