(data stored in SCRATCH zone)

EMBL: AP010803.PE676

AP010803.PE676       Location/Qualifiers
FT   CDS_pept        678541..679167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06760"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95510"
FT                   /db_xref="GOA:D4YYS8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYS8"
FT                   /protein_id="BAI95510.1"
FT                   /translation="MSRRLPLIPTLIVAAAVLVMIGLGVWQLQRRAEKEATLALVAANP
FT                   AKPPVAFPAHPPVPPELLFRRSSAHCLRVVRWRSEAGRAADGSVGYRYIAECATGAEGP
FT                   GVLVAAGVAKTPDARPQWQGGQMRGWIGEEPDHRSLLSRIGGQAMPLRPMLIAGEPVPG
FT                   LKPLAPPTAADVPNNHLAYAGQWFFFAAIAAIIYLLALRRRTPRP"
     atgagccgcc gcctgcccct catccccacg ctgatcgtcg cggcggcggt gctggtcatg        60
     atcggcctcg gcgtctggca actccagcgc cgcgccgaaa aggaagcgac gctggccctg       120
     gttgccgcca atccggccaa gccgcccgtc gctttcccgg cccatccgcc ggtgccgccc       180
     gaacttctgt tccgccgctc ctccgcccat tgcctgcgcg tggtccgctg gcgtagcgag       240
     gcggggcgcg ccgccgacgg atcggtcggc taccgctata tcgccgaatg cgcgaccggc       300
     gcggaaggcc ccggcgtgct ggtcgcggcg ggcgtcgcga agacgcctga cgcaaggccc       360
     caatggcagg gcggccagat gcgcggctgg ataggggagg aacccgatca ccgatccctt       420
     ctgtcgcgca tcggcggcca ggccatgccc cttcgcccca tgctgatcgc cggggagccg       480
     gtgcctggcc tcaagccgct ggccccgccc accgccgccg acgtgcccaa caaccatctg       540
     gcctatgccg ggcaatggtt cttcttcgcc gccatcgcgg cgatcatcta cctgctcgcg       600
     ctgcgcagac ggacgccgcg accttaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page