(data stored in ACNUC7421 zone)

EMBL: AP010803.PE68

AP010803.PE68        Location/Qualifiers
FT   CDS_pept        complement(65447..65746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94902"
FT                   /db_xref="GOA:D4YX20"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX20"
FT                   /protein_id="BAI94902.1"
FT                   /translation="MTRRQALDDPEIARVAWRRFRRIMAWMALTGALCVGAALLFLRWW
FT                   AGPMPIHMVIATILGVWLTFMLGTGLMALAFLSSGTGHDEQIIDRMKDEVPDND"
     atgacgcgca gacaagctct tgacgatccg gagatagcca gggtcgcgtg gcggcggttc        60
     cgccgcatca tggcgtggat ggcgctgacc ggcgcgctat gcgtgggggc ggcgctgctc       120
     tttctgcgct ggtgggcggg gccgatgccg atccacatgg tcatcgcgac gatattgggc       180
     gtctggttga cgttcatgct ggggacgggc ctgatggccc tggcatttct gtccagcgga       240
     acaggacatg acgaacagat catcgaccgc atgaaagacg aggttcccga caatgactga       300
//

If you have problems or comments...

PBIL Back to PBIL home page