(data stored in SCRATCH zone)

EMBL: AP010803.PE680

AP010803.PE680       Location/Qualifiers
FT   CDS_pept        complement(682199..682873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95514"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT2"
FT                   /protein_id="BAI95514.1"
FT                   /translation="MKARAALLALTLPALVGARPPMRYQPDPSSVFAAELAFNRLAQQK
FT                   GQWTAFRETAADEAVMFVPQRVLAKQWLKGRADPPAPVSWTPSAIYVSCDGDLAASTGG
FT                   WKRPDGSVGYFTTIWQRDRKGEWKWVMDHGDTLASAREAPEFLIGKVATCKRSLAGGAP
FT                   RPASPPPGRKAAKGEMPTAPRDESLSWNAEAAADGSRRVTVRMWNGTDYETVIDDRVAA
FT                   AP"
     gtgaaggcgc gcgcggcgct tcttgccctg acattgccgg cgctggtggg cgcgcgcccg        60
     cccatgcgtt atcagcccga ccccagttcc gtgttcgccg ccgaactcgc cttcaaccgg       120
     ctggcgcagc agaaggggca atggaccgcc ttccgcgaaa ctgctgcgga cgaggccgtc       180
     atgttcgtgc cgcagcgggt cttggcgaag caatggctga aggggcgggc cgacccccct       240
     gccccggtaa gctggacgcc gtcggccatc tacgtgtcct gcgacggcga tctggcggcc       300
     agcaccggcg gctggaagcg gccggacgga tcggtcggct atttcaccac catctggcag       360
     cgggacagga agggcgagtg gaaatgggtc atggaccatg gcgacacgct cgccagcgcc       420
     cgtgaagcgc ccgaattcct catcggcaag gtcgcgacct gcaagcgctc cctcgcagga       480
     ggggccccgc gccccgccag ccctccgccg ggccgcaaag cggcaaaggg cgagatgccg       540
     acggctcccc gcgacgaaag cctgagctgg aacgcagagg ccgcagccga cggcagccgc       600
     cgcgtgaccg tgcgcatgtg gaacgggacc gactatgaaa ccgtgatcga cgacagggtg       660
     gccgcggcgc catga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page