(data stored in ACNUC7421 zone)

EMBL: AP010803.PE682

AP010803.PE682       Location/Qualifiers
FT   CDS_pept        complement(683778..684089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06820"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95516"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT4"
FT                   /protein_id="BAI95516.1"
FT                   /translation="MTVWSRDGDDLILSVRLTPGAAREEVGGVWTDDKGANWLSARVRA
FT                   VPERGKANAALIALLAKRLDWPRGAISLESGDANRLKRLRIKGGGEALASGRLSTIIE"
     gtgacggtct ggagccggga cggagacgac ctcatccttt ccgtccggtt gacgccgggc        60
     gcggcgcggg aagaggtcgg cggcgtctgg acggacgaca agggcgcgaa ctggctgagc       120
     gcccgcgtcc gcgccgtgcc ggaaaggggc aaggccaatg cggcgctgat cgcgctgctg       180
     gcgaagcggc tggattggcc acgcggcgcg atttcgctgg aatcgggcga cgccaaccgg       240
     ctaaagcggc tgcggatcaa ggggggcggt gaagcgttag cctctggccg gctctccacc       300
     attatcgaat aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page