(data stored in SCRATCH zone)

EMBL: AP010803.PE683

AP010803.PE683       Location/Qualifiers
FT   CDS_pept        complement(684086..684376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06830"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95517"
FT                   /db_xref="GOA:D4YYT5"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT5"
FT                   /protein_id="BAI95517.1"
FT                   /translation="MAYALYQIIVILLDVLWWIIIIQAIMSWLIAFNVVNLSNDFVRTV
FT                   MVALDRMTAPIYNPIRRVLPDLGALDLSPMVVLLGILIIRQAILPPLFGLV"
     atggcctacg ccctctatca gatcatcgtc atcctgctcg atgtgctgtg gtggatcatc        60
     atcatccagg ccatcatgag ctggctgatc gccttcaacg tcgtcaatct ttccaatgat       120
     ttcgtgcgca cggtgatggt ggcgctggat cggatgacgg cgcccatcta caatccgatc       180
     cgccgggtgc tgccggacct gggggcgctg gacctgtcgc ccatggtcgt gctgctgggc       240
     attctgatca tccgccaggc catattgccg ccgctgttcg gactggtgtg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page