(data stored in ACNUC7421 zone)

EMBL: AP010803.PE685

AP010803.PE685       Location/Qualifiers
FT   CDS_pept        complement(685508..686179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06850"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95519"
FT                   /db_xref="GOA:D4YYT7"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT7"
FT                   /protein_id="BAI95519.1"
FT                   /translation="MASHPAPIARSLFVFSIFYGGMVCIAGVLGNKQVTLGPLSAIGPW
FT                   FGLGPLAVEAGIFAFLLLVTISSAVTELHGRAVANRLVQVGFLPLIASILLSIAVLAVP
FT                   AASDMDPARRDAFALMMGGTPRIWLGGIVAYGISQTLNVTLFAALKGREGGRLLWLRAA
FT                   VASILSQIADTLLFVSIAFYGVFPIGELLLGQMLAKVALSALLVPPVIYALVALGRRLD
FT                   R"
     atggcttcgc atcccgcgcc catcgcgcgt tcgcttttcg tcttctcgat cttctacggc        60
     ggcatggtct gcatcgcggg cgtgctcggc aacaagcagg tgacgctggg accgctgtcg       120
     gccatcggcc cctggttcgg ccttggcccg ctggcggtgg aggcgggcat cttcgccttc       180
     ctgctgctgg tgacgatttc cagcgcagtg acggaattgc acggccgcgc cgtcgccaac       240
     cggctggtgc aggtgggctt cctgccgctg atcgcctcca tattgctgtc catcgccgtg       300
     ctggccgtgc ccgccgcgag cgacatggac ccggcaaggc gagacgcctt cgcgctgatg       360
     atgggcggca cgccgcgcat ctggttgggc ggcatcgtcg cctacggcat ttcccagacg       420
     ctgaacgtca ccctcttcgc cgcgctgaaa ggcagggagg gcggccgcct cctctggctg       480
     cgcgccgcgg tggccagcat cctctcccag atcgcggaca cgcttctctt cgtgtccatc       540
     gccttctacg gcgtgttccc catcggcgaa ctgctgctgg gccagatgct ggcgaaggtc       600
     gcgctgtcgg ccctgctggt gccgccggtc atctacgcgc tggtcgcgct ggggcggcgg       660
     ctcgaccgct aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page