(data stored in ACNUC7421 zone)

EMBL: AP010803.PE687

AP010803.PE687       Location/Qualifiers
FT   CDS_pept        complement(686866..687621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95521"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT9"
FT                   /protein_id="BAI95521.1"
FT                   /translation="MRKSIFGLSALALAAMSAPAFAQDEPAPELTVTGNAAVVTDYRFR
FT                   GISQTDKRFALQGGLTVTHASGFYVSTWGSSIDDYVAAGSDQELDLIAGYSKTVGAATF
FT                   DLGVLYYYYPGSGGGNTDFVEPYASVKGTFGPATAKLSAAYAPKAKALSVGNGKEDNLY
FT                   LAGDLSASIPNTPLGVSAHLGHSFGPSYLVPVGKGYTDWSVGATYTWSHLTFGVSYVDT
FT                   DTHFRPNAGVGNFRDAARGGVVGSITASF"
     atgcgtaagt ccatattcgg cctctcggcc cttgcccttg ccgccatgtc ggcgccggcc        60
     ttcgcccagg acgagcccgc tccggaactc accgtgaccg gcaacgccgc cgtggtcacg       120
     gattatcgct tccgcggcat ttcgcagacc gacaagcgct tcgcgctgca gggcggcctc       180
     accgtgaccc atgcgtccgg cttctatgtc tcgacctggg gcagctcgat cgatgactat       240
     gtcgccgccg gcagcgacca ggaactcgac ctgatcgccg gctattccaa gaccgtcggc       300
     gcggccacct tcgatctcgg cgtgctctat tactactatc ccggctcggg cggcggcaac       360
     accgacttcg tcgagcccta tgcctcggtc aagggcacgt tcggcccggc gaccgccaag       420
     ctgagcgcag cctatgcgcc caaggcgaaa gccctgtccg tcggcaacgg caaggaagac       480
     aatctgtacc tcgcaggcga cctgtcggcc agcatcccga acaccccgct gggcgtgtcg       540
     gcgcatctgg gccacagctt cggtcccagc tatctggttc ccgtcggcaa gggctatacc       600
     gactggagcg tcggcgcgac ctatacatgg agccatctga ccttcggcgt cagctatgtg       660
     gacaccgaca cccatttccg gcccaatgct ggcgtcggca acttccgcga cgcggcaagg       720
     ggtggcgtgg tcggttccat caccgcgtcc ttctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page