(data stored in ACNUC7421 zone)

EMBL: AP010803.PE69

AP010803.PE69        Location/Qualifiers
FT   CDS_pept        65822..66250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00690"
FT                   /product="CBS domain protein"
FT                   /note="FOG: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94903"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX21"
FT                   /protein_id="BAI94903.1"
FT                   /translation="MTIAAILQRKGQDVVQVQSSDTVLSVVRLLAQRRIGCVPVVDDGE
FT                   VVGIFSERDLAYRVAQEGAAVLDRPVGEIMTAPAITTDDRTPVNHCLSLMTKRRIRHLP
FT                   VVVDGALVGLVSIGDLVKFRIDSIESEAAALRDYIQTA"
     atgacgatcg cggcgatttt gcaacgcaag ggacaggatg tcgtccaggt gcaatcgagc        60
     gacacggtgc tgtccgtggt gcgattgctg gcccagcggc ggatcggctg cgtgccggtg       120
     gtggacgacg gcgaggtagt gggaatcttc tccgaacgcg acctggccta tcgcgtggcg       180
     caggaaggcg cggcggtgct ggaccgcccg gtgggggaga tcatgacggc cccggccatc       240
     accacggacg atcggacgcc cgtcaaccat tgcctgtcgc tgatgacgaa acggcgcatc       300
     cggcacctgc ccgtcgtggt cgacggcgcg ctggtggggc tggtgtcgat aggcgatctg       360
     gtgaagttcc gcatagattc gatagaatcc gaagcggccg ccttgcgcga ttatatccag       420
     acggcctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page