(data stored in ACNUC7421 zone)

EMBL: AP010803.PE691

AP010803.PE691       Location/Qualifiers
FT   CDS_pept        complement(691294..692478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95525"
FT                   /db_xref="GOA:D4YYU3"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU3"
FT                   /protein_id="BAI95525.1"
FT                   /translation="MGFRFSLLFAAPLLLAAPALAQQDNGAEPVFNLPRTPAQPRTDPN
FT                   AQGPELDVFRGAPTPATPPPVVAPTIQLPPIAAPVPTPAPAQNQPVQRSAEPVRPPQAA
FT                   PQSQAPAESAVPGEAAPPPPPAADQNLPSADNGTVSSPTPVSPSPPERPSAPAWPWIAA
FT                   AAAAAMLLIGAYSWLRRRRQDAAEEPPYEAEAEADTAPPPPPPPPSATPAPPEPEAAPD
FT                   DADRPWIELAMDVQAARLTLLGATIGYRLTLRNRGTRAAEDILVRSLIANADAQQQALF
FT                   QSFFAGETGLPVHSVVSIAPGETQKLSGEMRLDAQAIAAIPMGQRALLIPLIAFDAHYR
FT                   WTGESEGTGRSGGVFIVGEEQSPPAERLSPFRLDLGPRQYRAPGSRATALSLSS"
     atggggtttc gcttctcgct tctgttcgcc gcgccgctgc tgctggccgc gcctgccctc        60
     gcgcagcagg acaatggcgc ggagccggtc ttcaacctgc cgcgcacgcc cgcgcagccg       120
     cggaccgatc ccaatgcgca ggggccggaa ctggacgtgt tccgcggcgc gccgacccca       180
     gcgacgccgc cgccggtcgt cgcgccgacg attcagcttc cgcccatcgc cgcgccggtc       240
     ccgacgccgg caccggcgca aaaccaacct gtccagcgat ccgccgagcc ggtgcgcccg       300
     ccgcaagccg caccgcaaag ccaggccccg gccgaaagcg cggttcccgg cgaagccgct       360
     ccgccgccgc ctcccgccgc cgaccagaac ctcccctctg ccgacaacgg cactgtttcg       420
     agtccgacgc cggtatcgcc aagtccgcct gagcggccgt ccgcgcccgc atggccctgg       480
     atcgccgccg cagcggcggc cgccatgctg ctgatcggag cctattcctg gctgcgccgc       540
     cgcaggcagg acgcggcgga ggaaccgcct tacgaagctg aagccgaagc cgacaccgcg       600
     ccgccgccgc cccctccgcc tcccagcgca acgcctgccc cgcccgaacc cgaagccgcg       660
     ccggacgatg ccgaccgccc atggatcgaa cttgccatgg acgtgcaggc cgcccgcctg       720
     acattgctgg gcgcgaccat cggctatcgg ctgacgctcc gcaatcgcgg cacccgcgcg       780
     gcggaggaca tcctcgtccg cagcctgatc gccaatgccg atgcgcagca acaggcgctg       840
     ttccagtcgt tcttcgcggg cgaaaccggc cttcccgtcc attcggtggt atccatcgcg       900
     ccgggcgaaa cgcagaagct cagcggggaa atgcgcctcg acgcccaggc gatcgccgcg       960
     atccccatgg gccagcgcgc cctgttgatc ccgctgatcg ccttcgacgc ccattatcgc      1020
     tggacgggcg agagcgaagg gacgggacgc agcggcggcg tcttcatcgt cggggaggaa      1080
     cagtcgcccc cggccgagcg cctttccccc ttccgccttg atcttggccc gcgccaatac      1140
     cgcgcgccgg gcagccgcgc gaccgcgctc agcctctcca gctaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page