(data stored in ACNUC7421 zone)

EMBL: AP010803.PE695

AP010803.PE695       Location/Qualifiers
FT   CDS_pept        complement(698124..698906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06950"
FT                   /product="putative lipolytic enzyme"
FT                   /EC_number="3.1.2.-"
FT                   /note="lipolytic enzyme, G-D-S-L family/lysophospholipase
FT                   L1 or related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95529"
FT                   /db_xref="GOA:D4YYU7"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU7"
FT                   /protein_id="BAI95529.1"
FT                   /translation="MRTANINSVRCIGIKVASALLGLGLLIGPGGALRAAEPQIPAPTI
FT                   PAPRINADPAFPFSREIEAFAKANEAGPAVADATLFLGSSSIRLWDIGGSFPDIGTVNR
FT                   GFGGATTPDVLHYYKRLLPRAKPRSILVYVGENDLAAGASPGEVANNVLTLLRQLRTDY
FT                   PKAHIAYLSLKPSPIRWTLWPKMAAVNMTVAARSRVTRFDYLDVGRVLLAADGLPDASL
FT                   FRPDGLHMNPRGYMLWTQLVDAYLDEAVAAERKPVSPS"
     atgcgaacgg caaatatcaa ctccgtccgc tgcatcggca ttaaggtcgc gtccgcgctg        60
     ctcggccttg gcctgctgat cgggccgggc ggcgcgttgc gggcagcgga gccgcagatc       120
     ccggcgccca ctattccggc gcccaggatc aacgccgatc ccgccttccc cttttcccgg       180
     gagatcgagg ccttcgccaa ggccaatgag gcggggccgg cggtcgccga cgccacgctg       240
     ttcctgggca gttccagcat ccgcctgtgg gacattggcg ggagcttccc cgacatcggc       300
     acggtcaatc gcggctttgg tggcgcgacc acgcccgacg tgctgcatta ttacaagcgc       360
     ctgctgccca gggcgaagcc gcgctccatc ctggtctatg tcggggaaaa tgatctggcg       420
     gcgggcgcat cgccgggcga ggtcgccaac aatgtcctga ccctgctgag gcaactccgc       480
     accgattatc ccaaggcgca tatcgcctat ctgtcgctga agcccagtcc gatccgctgg       540
     acgctctggc cgaagatggc ggcggtcaac atgacggtgg cggcgcggtc gcgggtgacg       600
     cgcttcgatt atctggacgt cggccgcgtg ctgctggcgg ccgacggcct gcccgacgcg       660
     tcgctgttcc ggcccgacgg gctgcacatg aacccgcgcg gctatatgct ctggacccaa       720
     ttggtggacg cttatctgga cgaggccgtc gccgccgagc gcaagccggt ttccccttcc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page