(data stored in ACNUC7421 zone)

EMBL: AP010803.PE696

AP010803.PE696       Location/Qualifiers
FT   CDS_pept        complement(698863..699234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06960"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95530"
FT                   /db_xref="GOA:D4YYU8"
FT                   /db_xref="InterPro:IPR011722"
FT                   /db_xref="InterPro:IPR036623"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU8"
FT                   /protein_id="BAI95530.1"
FT                   /translation="MNDMIQIFGPDVTAPPIVHARFSLGDVVQHRLFGFRGVVFDIDPV
FT                   FANTEEWYQAIPEEVRPDKHQPFYHLLAENGESSYVAYVSQQNLVADDSEEPVDHPAIS
FT                   GMFGTYANGKYQLRPLHRH"
     atgaacgaca tgattcagat tttcggaccc gatgttaccg ccccgccgat cgtccacgcc        60
     cgcttcagcc tcggcgatgt ggtgcaacat cgcctcttcg gttttcgcgg cgtggtgttc       120
     gatatagatc cggtcttcgc caataccgaa gaatggtacc aagccattcc cgaggaggtc       180
     cggccggaca agcaccagcc cttctaccac ctgctcgccg aaaatggcga aagcagctat       240
     gtcgcctatg tcagccagca gaatctggtc gcggacgaca gcgaggagcc tgtcgaccat       300
     cccgccatct ccggcatgtt cggcacctat gcgaacggca aatatcaact ccgtccgctg       360
     catcggcatt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page