(data stored in ACNUC7421 zone)

EMBL: AP010803.PE697

AP010803.PE697       Location/Qualifiers
FT   CDS_pept        699799..700092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95531"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU9"
FT                   /protein_id="BAI95531.1"
FT                   /translation="MGRIRPGGEALDDPSCAHEGSARACHSLVSPGTRYPSDKPEAVDR
FT                   VGRSRQATKRHFLPLALSSRQLKRTSPRMHLLHGGRNKSGHTFICSRAVAIG"
     gtgggaagaa ttcgacctgg aggagaggct ctggacgatc ccagctgcgc gcatgaaggc        60
     agcgcgcgag catgtcattc ccttgtcagc cccggcactc gctatccttc ggacaagccg       120
     gaagcggtcg atcgtgttgg tcgaagcaga caagcgacca agcgccactt cttgccgtta       180
     gctttgagtt cacgtcagct gaagcggaca tctcctcgaa tgcacctcct gcatggcggc       240
     cgaaataaat cgggacacac attcatttgt tctcgcgcgg ttgcaatcgg atga             294
//

If you have problems or comments...

PBIL Back to PBIL home page