(data stored in ACNUC7421 zone)

EMBL: AP010803.PE698

AP010803.PE698       Location/Qualifiers
FT   CDS_pept        complement(700146..701333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06980"
FT                   /product="HlyD-family secretion protein"
FT                   /note="type I secrection membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95532"
FT                   /db_xref="GOA:D4YYV0"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV0"
FT                   /protein_id="BAI95532.1"
FT                   /translation="MTANIYARIDPQKESRWLRLIGSLRIIPLVSAGVIAFFIWSYFGV
FT                   LDEVAVGPGKVTPPSRSQVIQSLEGGIVNGIFVHEGDIVKPRQQLATLDRARFSSMLGE
FT                   AEAKARALEAAAARLEAEINGGMPRFSADVQALPALVAREMQLLRSRRENLEVATASLR
FT                   QSLALTRRQLAMTEPLVDLGAANRVEIIQLQRQENELQAKLDSLRNQYVIDANAEYAKT
FT                   RSELDVIDQVIGGRRDQLNRTRLISPVRGIVKNLEVTTIGGVIQPGGSLMEIVPLEDEL
FT                   LVEARISPRDIAFIRPGQPATVKITAYDPSIYGTLDGTVDRISPDTLQDEVNREQVYYR
FT                   VYVRTRHSSLRTKDGREHAIMPGMVANVEIRTGRKTVLQYLLKPINKAKEAMRER"
     atgaccgcca acatctatgc ccgcatcgat ccgcaaaagg aaagccgctg gctccgcctg        60
     atcggtagcc tgcgcatcat tccgctggtg tcggcagggg tcatcgcctt tttcatctgg       120
     agctatttcg gcgttctgga cgaggttgcc gtgggcccgg gcaaggtcac gccgccatcc       180
     cgttcgcagg tgatacaaag tctggaaggc ggcatcgtca acggcatatt cgtccatgaa       240
     ggcgacatag tgaagccgcg tcagcaactt gcgacgctgg atcgcgcgcg cttcagctcg       300
     atgctcggcg aagcggaggc gaaggcgcgc gcgctggaag ccgcggccgc ccggctggag       360
     gcggaaatca atggcggcat gccgcgcttc agtgcggatg tgcaggccct ccccgcgctt       420
     gtcgcgcgcg aaatgcagct cctccggtcc cgccgcgaaa atctggaggt tgccactgcc       480
     agtctgcgtc agtcacttgc cctgacgcgg cggcaactgg cgatgacgga gccgctcgtg       540
     gatctgggcg ccgcgaaccg ggtcgaaatc atccagcttc agcggcagga gaatgagctg       600
     caggccaagc tcgattccct gcgcaaccaa tatgtgatcg acgccaacgc ggaatatgcc       660
     aagacccggt ccgaactcga tgtcatcgac caggtcatcg gcggacgccg cgatcagctt       720
     aaccgcaccc ggttgatctc gccggtgcgc ggcatcgtca agaatctgga ggtcacgaca       780
     attggcggcg tcatccagcc tggcggatcc ctgatggaga tcgttccgct ggaggatgaa       840
     ctgcttgtcg aggcgcgcat cagcccccgc gacattgcct tcatccgccc cggccagccg       900
     gccacggtca agatcaccgc ctatgaccca tccatctatg gcacgctgga cgggacggta       960
     gatcgcatct ccccggacac cttgcaggac gaggtcaacc gcgagcaggt ctattatcgc      1020
     gtctatgtcc gtacgcgcca ctccagcttg cgcacgaaag acgggcgcga acatgcaatc      1080
     atgccgggca tggtcgccaa tgtcgaaatc cgcacgggac gcaagacggt gcttcaatat      1140
     ctgctgaagc ccatcaacaa agcgaaggaa gccatgcgag agcgttag                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page