(data stored in ACNUC7421 zone)

EMBL: AP010803.PE699

AP010803.PE699       Location/Qualifiers
FT   CDS_pept        complement(701330..703477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-06990"
FT                   /product="putative type I secretion protein ATP-binding
FT                   protein"
FT                   /note="ABC-type bacteriocin/lantibiotic exporter, contain
FT                   an N-terminal double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95533"
FT                   /db_xref="GOA:D4YYV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV1"
FT                   /protein_id="BAI95533.1"
FT                   /translation="MADFSDVSDNPWVSAIARLATLKGVQVTSSELMTRLYWSPDADME
FT                   QLLVHAARLSGIRFEIIQMAIDTIPAMLLPAIVELRDGRSVLLLSRDGDSARITMPALR
FT                   RDAPTDISLAELQVQATGRIGFVEPLSTKSRDARLDEFLRKPSRSWLWDVIMGDRRGYG
FT                   EVMIGSLVGNLLTFATSLFAMQVWDRVIPAQSLPTLWVLALGAGMALLLELMLRTARVQ
FT                   LVDRIGRRADLEISARVFARALDIRNDARPRSTGALITQLRDIEQVREMLTSTTVGALI
FT                   DLPFIILFLALFTLLAGPLTFVLIGAAALIVVPGILLQRPLARLAGEGMREAALRNAIL
FT                   VESIERIDEIKAAQAEPRFQSMWERLTLANTRVGAEQRFVAAFFTNWTQTLQQLAYTVV
FT                   ILAGAFRVMSGDMTMGAVIACSILTSRALVLFVPFGQIFTRWQNAKVALAGLDDLLAKP
FT                   VDHDPEQGLLRRSGLRGHYEARDLRFAYDPESAPALTIDRLTISAGERVALLGRIGAGK
FT                   STLLRLLAGLARPTGGDLLLDGTAMTLINPVDVRRDTGYLGQGAQLFLGTIRENLLIGA
FT                   PGATDDQILEALRVSGGLPLLQSQPKGLDLLLQEGGAGLSGGQRQTLLLARVLLRNSNI
FT                   LLLDEPTAPLDEISERNLVAQLGAWLVGRTLIVTTNRPGLLELVDRIIVIDGGRVTVDG
FT                   PKTRVLAQLQRPPVSRAEQNR"
     atggctgatt tctccgacgt ctccgacaat ccctgggtca gcgccattgc cagactggcc        60
     actctgaaag gcgtgcaggt aacgagcagc gagttgatga cgcggctata ctggtcgccc       120
     gatgccgaca tggagcagct tctggtgcac gccgcgcgcc tgtccggcat ccgcttcgaa       180
     atcatccaga tggcgatcga cacgatcccg gccatgctgc tgcccgccat tgtcgaacta       240
     cgcgacggcc ggtcggtgct gctcctctcg cgggacgggg acagcgcccg gatcacgatg       300
     cccgcgcttc gccgcgatgc gccgacggac atatcgcttg ccgaattgca ggtgcaggct       360
     accggccgga tcggctttgt cgaaccgctt tccaccaaat cgcgcgatgc ccgtcttgac       420
     gaatttctgc gcaagcccag ccggtcgtgg ctctgggatg tgatcatggg cgacaggcgc       480
     ggctatggtg aggtgatgat tggatcactg gtcggcaacc tgctgacttt tgccacatcg       540
     ctattcgcga tgcaggtatg ggaccgcgtg attccggcgc aatctctgcc gacgctctgg       600
     gtgctggcgt tgggtgccgg catggcgctg ctgcttgaat tgatgctgcg gaccgcccgt       660
     gtccagctcg tcgaccggat cggccgcagg gcggacctgg agatcagcgc gcgcgtcttc       720
     gcccgtgccc tcgacatccg caacgacgca cgtccgcgct cgaccggcgc cctcatcacc       780
     cagctgcgcg acatcgaaca ggtgcgggag atgctgactt caaccaccgt tggggcgttg       840
     atcgatttgc ccttcatcat cctgttcctg gcgctgttca ccctcctcgc aggtcctttg       900
     accttcgttc tgatcggcgc ggcggcgctg atcgtcgttc cgggcatcct gctacagcgg       960
     ccgctggcgc gcctggctgg cgaaggaatg cgcgaagcgg cgcttcgcaa cgccatattg      1020
     gtcgaatcca tagagcgcat cgatgaaatc aaggccgccc aggccgaacc ccgtttccag      1080
     tccatgtggg aaaggctgac gctcgccaat accagggtcg gcgcggagca acgcttcgtc      1140
     gccgcattct tcaccaattg gacgcagacg ctccagcaac tggcctatac cgtcgtgatc      1200
     ctggccggtg ccttccgcgt gatgagcggc gacatgacca tgggcgcggt catcgcctgc      1260
     tccatcctca ccagtcgcgc tctcgtgctg ttcgtgcctt ttggccagat cttcacccgc      1320
     tggcagaatg ccaaggtggc actggcggga ctggatgacc tgcttgccaa gcccgtcgat      1380
     cacgaccccg aacagggcct gctgcgccga agcggcctgc gcggtcatta tgaggcaagg      1440
     gatctgcgat ttgcctatga tcccgaatcc gctcccgcgc tgacgatcga ccggctgacg      1500
     atcagtgccg gggaacgggt cgccctgctg gggcggatcg gcgcgggcaa atcgacgctc      1560
     ctgcggctgc tggcgggcct tgcccgtcct accggcggcg acctgctgct ggacggcacc      1620
     gccatgacat tgatcaatcc cgtcgatgtc aggcgcgaca ccggttatct tggccagggc      1680
     gcgcaactgt tcctgggcac cattcgggaa aatctgttga tcggagcgcc gggcgcgact      1740
     gacgaccaga tattggaggc cctgcgcgtg agcggggggc tgcccctgct gcaaagccag      1800
     cccaagggac tggacctgtt actgcaggag ggcggcgcag gcctttccgg cggacagcgg      1860
     cagaccttgc tgctggcgcg cgttctgctg cgcaacagca acatcctgct gctcgacgag      1920
     ccgacggccc cgctcgacga gatcagcgag cgtaacctcg tcgcccagct gggcgcctgg      1980
     ctggtcggcc gcaccctgat tgtcaccacc aatcgtcccg gcctgctgga actggtcgac      2040
     cgcatcatcg tcatcgatgg cggccgggtc acggtggacg gcccgaagac gcgggttctg      2100
     gcacagttgc aaagaccgcc tgtatcgcgg gcggagcaaa atcgatga                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page