(data stored in ACNUC7421 zone)

EMBL: AP010803.PE70

AP010803.PE70        Location/Qualifiers
FT   CDS_pept        complement(66257..67750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00700"
FT                   /product="putative membrane protein"
FT                   /note="membrane protein involved in the export of O-antigen
FT                   and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94904"
FT                   /db_xref="GOA:D4YX22"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX22"
FT                   /protein_id="BAI94904.1"
FT                   /translation="MKMSLQDADAGDAGFGSRIRSAILWRSGSQIVAQMLSWVVTLAVI
FT                   RLLDPADYGLFAMTQVILNFATFLNGYGLVSALVQSETVETHKLRQAFGIMLLLNGGLA
FT                   LAQLAVAPLAAAYYAQPMVADLLRVQALLYLSTPFISIPEAIMGRAMDFRRPALVNLIA
FT                   AMASAAVALSGALSGWGVWTLVFAPIAGFWVKGIGYVLATGFMPVPSFDFRGTGAMVAY
FT                   GASLLGGQLFWIVQSQADIFIGGRVLEPHQLGLYAEALFLTQIFVSKFIPPLNDVAFPA
FT                   YARMQKDPSRIAWSFCKAVRLLLLISCPVYLGMAVTAGPLVETLFGAKWRDMAPFVAIL
FT                   ALAMPFMTLQVMFAPVSNAVGRPGTTARIAAVGAVLMPAAFLIGIRFGAIGLAWAWLFA
FT                   FPILTLITARLAGAPMGLRLIDLARAAAPGLGCSLLMAAAVMGIDRLLPPLAAPIRLGI
FT                   LVPAGGLAFLAALMLCAHGTLMELVALVTRRAPPVEAPA"
     atgaagatga gtttgcagga cgccgacgca ggcgacgccg gtttcggctc aaggataagg        60
     agcgcgatcc tctggcgatc gggcagccag atcgtggcgc agatgctgag ctgggtcgtg       120
     acattggcgg tgattcggct gctcgatccc gccgattacg gcctgttcgc gatgacgcag       180
     gtgatcctga acttcgcgac cttcctcaac ggctatgggc tggtgagcgc gctggtgcag       240
     tcggagacgg tcgaaacgca caagctgcgg caggcattcg gcatcatgct gctgctgaac       300
     ggcgggctcg ccctggcgca gcttgcggtc gcgccgctgg ctgcggccta ttatgcgcag       360
     cccatggttg cggacctgct gcgggtgcag gcgctgctct atctgtccac gcccttcatc       420
     tcgattcccg aagcgatcat ggggcgggcg atggatttcc ggcggccggc attggtcaac       480
     ctgatcgcgg ccatggcttc ggcggcggtg gcgctgtcgg gtgcgctgtc gggctggggc       540
     gtgtggacat tggtgttcgc gcctatcgcg ggattctggg tcaaggggat cggctatgtg       600
     ctggcgaccg ggttcatgcc cgttcccagc ttcgattttc gcgggaccgg ggcgatggtg       660
     gcctatggcg cgtcgctgct gggcgggcag ttattctgga tcgtgcagag ccaggccgac       720
     atcttcatcg gcgggcgcgt gctggagccg catcaactgg gcctttatgc agaggccctg       780
     ttcctgacgc agatcttcgt cagcaagttc atcccgccgc tgaacgacgt ggccttccca       840
     gcttatgcgc ggatgcagaa ggatccgtcg cgaatcgcct ggtccttctg caaggcggtg       900
     cggctgctgc tgctgattag ctgccccgtc tatctgggga tggccgtgac ggcggggccg       960
     ctggtcgaga cgctgttcgg cgcgaaatgg cgggacatgg cgcccttcgt cgcgatcctg      1020
     gcgctcgcca tgccgttcat gacgttgcag gtgatgttcg cgccggtcag caatgcggtg      1080
     ggccggccgg ggacgacggc gcggatcgcg gcagtaggcg cggtgctgat gccggccgcc      1140
     ttcctcatcg ggattcgatt cggggcgatc gggctggcct gggcatggct ttttgctttt      1200
     ccgatcctaa cgctgatcac tgcccggctg gcgggcgcgc ccatgggcct gcggctgatc      1260
     gacctggcgc gggcagcggc gccggggctt ggctgttcgc tgttgatggc ggcggcggtg      1320
     atggggatcg accggctgct gccgcctctc gccgcgccga ttcggctggg gatattggtg      1380
     ccggcgggcg ggctggcctt tctggccgcg ctgatgctgt gcgcgcatgg gacgcttatg      1440
     gaactggtgg cgctggtaac gcggcgggcg ccgccggtgg aggcgccggc ctga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page