(data stored in ACNUC7421 zone)

EMBL: AP010803.PE700

AP010803.PE700       Location/Qualifiers
FT   CDS_pept        complement(703470..704579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-07000"
FT                   /product="RND-family efflux transporter"
FT                   /note="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95534"
FT                   /db_xref="GOA:D4YYV2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV2"
FT                   /protein_id="BAI95534.1"
FT                   /translation="MNKAGYQANLGPNMFSRSSGSGLNDNMAGPSLYLQQRIWDFGRAK
FT                   GEIGYARSTEEQRRYELESVADQLAEQAALAFLQVKRFELLGREAARQVEALEHLRELI
FT                   GLRVDAGISDKSDLMLANVRVDSARGDAILAESSLITARAALANLTGAMPTVYQDPNPQ
FT                   ITRFGAAEEEPDFASLPAIVAADKAEQAAAARVGQAKAERYPQLGLQLGYTRNNYTYNE
FT                   RNNAFSALVTVTGDLYKRGTRYQVRAAEEERRAARSARDSVLLDARGRALTARQEIRGG
FT                   ALRIEAFSHQEKQAEEASRIFFEEYKLGKRTLTELLNTQLEIYRAASARIVAEYDVLAA
FT                   RIRFENVRGTLRPSLGLPARLTEGEEEHG"
     gtgaataagg cgggctatca ggccaatctg gggccgaaca tgttttcccg atcaagcggt        60
     tcggggctta acgacaatat ggccgggccc agcctctatt tgcagcagcg catatgggat       120
     ttcggtcggg cgaaggggga gatcggctat gcccgctcga ccgaggagca gcgtcggtat       180
     gaactggaat cggtagcgga tcagcttgcc gaacaggccg ctctcgcctt cctccaggtg       240
     aagcggttcg agctgcttgg gcgggaggcc gcaagacagg tcgaggcgct ggagcatctg       300
     cgtgaattga tcggccttcg cgtcgatgcc gggatttccg acaaatccga cctgatgctt       360
     gccaatgttc gcgtggacag tgcgcgcggg gatgcaatcc tggcggaatc gtccctcatc       420
     accgcccgcg ccgcgcttgc caatctgacc ggggcgatgc cgactgttta tcaggacccg       480
     aacccgcaga tcacccgctt cggcgcagcc gaggaagagc ccgactttgc ctctcttccg       540
     gccatcgtcg ctgcggacaa ggccgaacag gccgccgccg cgcgagtcgg ccaggccaag       600
     gcggagcgct acccccaact gggactgcaa ctgggctata cgcgcaacaa ctacacatat       660
     aatgagagaa acaacgcctt ttcggccctc gtcaccgtca caggcgacct ctacaagcgc       720
     ggaacccgtt atcaggtccg cgcggcggag gaagaacgcc gtgccgcccg atcagcgcgc       780
     gactccgtgc tgctggatgc gcgaggccgg gcgctgacgg cccggcagga aatacgcggc       840
     ggtgcgttgc gcatcgaagc cttcagccat caggaaaagc aggcggagga agcaagccgc       900
     atcttcttcg aggagtataa gctcggcaag cgcaccctga ccgaattgct caacacccag       960
     ctggaaatct atcgcgcggc cagcgctcgc atcgtcgccg aatatgacgt gctggcggcg      1020
     cgcattcgtt ttgaaaatgt ccgtggaacg ttgcggccct cgctcggcct tcccgcgcgc      1080
     ctgaccgaag gagaggaaga gcatggctga                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page