(data stored in ACNUC7421 zone)

EMBL: AP010803.PE702

AP010803.PE702       Location/Qualifiers
FT   CDS_pept        complement(706510..713289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-07020"
FT                   /product="large repetitive protein"
FT                   /note="autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95536"
FT                   /db_xref="GOA:D4YYV4"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV4"
FT                   /protein_id="BAI95536.1"
FT                   /translation="MDKHVEIQQRGSKLPEKTAVTDRNAVVSVQPQSVIKVVAPPNSVS
FT                   SMLREGDDLIIHFADGSTIRLDGYFACPTEDISQLFVADPASAGEWLVSFTDAACGLAT
FT                   DATSQALSYAYTPMASGIGAAAAAGGGISDGLLAGLGALVLGGGIAAAAGGGGSNRGPA
FT                   GPVDQTPPAAPAISPSNGRSLSGTAEAGATVRIDLDANGSIDASVTADANGNWTYTPPN
FT                   PIANGTRISVTAVDSAGNVSTPSQITVDAAAPAAPTIDPTDGTMLNGSAEAGSTVNIDL
FT                   NGDGAPDASVVAGTDGRWAYTPAAPLVDGTTVTVTATDAVGNVSPPTSLTLDLSAPAAP
FT                   VLVTLTDDVGAIIGGIASGGATDDRQPTLGGTAEAGAKLSIYDGNVLLGETTADANGAW
FT                   SFTPAAPLAEGAHIISVTATDAAGNISAASPPFAFAVDTIAPAAPVLGPTDGTTISGTA
FT                   EIGATIELDTDGDGIADATTTADANGEWRIILPTSLANGTQVSATATDAAGNRSGPGSA
FT                   IVDTGLDTTPPAIPILGSVTDDVDPAQGPLSNGGATNDVRPLLAGGGVEAGATISIYDG
FT                   GTVIGTTTADGAGNWTFTPTDALGEGAHSLTVTATDAFGNESDASPAFVLTVDTVAPDT
FT                   PTIRPSNGAGLSGMAEPGATINLDLNGDGTVDVTVTADGTGEWQYVPDARLPDGATVIV
FT                   TASDPAGNLSPPASRVVDADVPVAPVITGIVDDVAPIIGGLANGASSNDVQPTFSGTAE
FT                   AGSTVYLYDNGAQIGTAAADGSGNWTFTPAALTDGAHSFSVTATDEAGNISGPSSPFVI
FT                   TVDTAAPAAPAMNPTDGNTISGTAEAGATIAIDINGDGAADATTTANSAGEWSVGLGTP
FT                   LGNGTLVSATASDSAGNSSGPSTVTVTTAIDSTPPPIPTFDSATDDVAPVLSALSSGAT
FT                   SNDTQPLLAGSGVEAGATVSIYDNGVLLGNGTVDGSGNWTFTPGAPLSEGAHSLTVTAT
FT                   DGSGNESAASAPFLLTIDTAAPGAPTISPSNGDVLTGTAEAGATINIDLDGNGSADTSV
FT                   TADPSGNWTFDPIGVVPDGTTVIVTASDAAGNVSGPASTVIDAIAPAAPAITALTDDQG
FT                   GSTGGISPGAATDDDRPAIAGTADIGATVLLFDNGTQIGTAAVDGSGNWAFTPAIALPD
FT                   GPHSFSARAVDAAGNVSSLSASFAITIDTLSPNAGAITGISDNVPGAIGPIPNGSLTND
FT                   AQPTLSGTADPGESVTIMDNGVAIGTAPVDGLGAWSFTPLAPLSDGAHSFTIVTVDAAG
FT                   NGSSASTAYAVTIDSAAPAAPVIDAAADNSGSITGTVAAGGSTDEVQPTLSGTVEPGST
FT                   VAIFSNGTPAGNASVDPAGNWTFTPALPLGDGTYNFTAVATDPAGNSSGLSSPFTITID
FT                   TAAPSLPIITQASDDVGGAPTPIAPGGLTDDALPVLSGTTEALATVTIFDNGTAIGTTT
FT                   ADGSGNWTFTPGSPLALGAHSITASAIDAVGNESLQGAPFNFTLIAVAGGIPVIGGVSD
FT                   DVGAVNGPVLNGGVTDDATPTLSGTGPASTTLAIFDNGTQIGTASTDGSGAWSFTPTTA
FT                   LTDGTHDLTAAEALGGGAFGPASGAFTINVDTAAPAAPAITVAIDDVAAFTGGITDGGL
FT                   TNDSAPEIRGTGEIGATVTLFDNGSPVGTAVVDASGNWSISPVGPLAEGLHSFTASAAD
FT                   EAGNAGPLSAAFTLTVDLTPPPAPTITAVTDDVAQQTGTVTNGGISNDVLPQISGTAIA
FT                   GSTVQIFDNGALLGTTVADGGGNWSFTPGGALANGSHGFTVAQLDSAGNASSPSPVYSV
FT                   TIDTVAPTAGIAITTLTQDTGVVGDWSTQDSAPTIAGTLTAPLSAGERVEIQIDGGAWV
FT                   SATASGTSWFYGPGTLAVGQHGVNVRVIDSAGNIGDVEAQQFTITNVNQAPIVQASGTS
FT                   LLGLVGAEALGLIDLSTQSLTAYDPNNNLRSVEVRFAPLLSANLGAFTLTASTALAAEL
FT                   GLQVSIANNPGLLGILAPSSVLTVTALDGGPISNQAINELLNTVHFNQDLTLLGLNVLD
FT                   TTTITATDMNGLTASSATGTLANLSLLNASGSSAVLEGNASANTINGTAANERLYGHGG
FT                   ADTLNGNGGNDLLRGGAGADTLNGGTGNDVLVHDAADASIDGGTGVDTLLIDSGTGMVL
FT                   NLDAVNNIRNIERIDLGVGDAGRQITLTEAGIIRATEASHQLIVTGDLNDSVTMTGATL
FT                   QGQTLINGQAFDHYALGTTNIYVEDPVMVVV"
     atggacaagc atgtcgagat ccagcaacgc ggatcgaagc ttccagagaa gacggctgta        60
     actgaccgga acgcggtcgt ctccgtccaa ccccaatccg tcataaaggt cgtcgctccg       120
     cccaatagcg tttcctccat gctgcgcgaa ggcgatgacc tcatcatcca cttcgccgac       180
     ggatctacca tccgactgga tggctatttc gcctgtccca ctgaagacat cagccagctg       240
     ttcgtcgcag acccagccag tgcgggcgaa tggctggtaa gcttcaccga tgccgcctgc       300
     ggtcttgcca ccgatgccac gagccaggcg ctgagctacg cctacacgcc catggccagc       360
     ggtattggcg cagcagcggc agcaggcggc gggatcagcg acgggctgct cgctggtctc       420
     ggcgcgcttg ttttgggggg tggcatcgcc gcagcagcgg gcggcggggg tagcaacaga       480
     gggcctgccg ggcctgtcga tcagacgcct cccgccgccc cggcaatatc ccccagcaat       540
     gggcgctccc tctccggcac ggcggaagcg ggggcaaccg ttcgcatcga tctggatgca       600
     aatggttcca tcgacgccag cgtgaccgcc gacgccaacg gcaactggac ctatacgccg       660
     cccaatccca tcgccaacgg cacccgcata tccgttacgg ccgtggacag cgctggaaat       720
     gtctccacac ccagtcagat cacggtggac gcagcggctc cggccgcgcc gacgatcgac       780
     cccacggacg gaaccatgct gaacggttcg gccgaagccg gttcgaccgt gaatatcgat       840
     ctcaatggcg atggcgcgcc cgatgcatcc gttgtcgcgg gaaccgacgg acgctgggcc       900
     tacaccccgg ccgcgccgct ggtggacggc accaccgtca cggtcaccgc cacggatgcc       960
     gtcggcaatg tctcgccgcc cacgtccctg accctggatc tgagcgcccc ggccgcgccg      1020
     gtccttgtca cgctgacgga cgatgtcgga gcgatcatcg gcggtatcgc cagcggcggc      1080
     gctaccgacg acaggcagcc gacccttggc ggcaccgccg aggctggagc gaagctttcc      1140
     atctatgacg gcaacgtgct gctgggcgag acgacggctg acgccaatgg cgcctggagc      1200
     ttcacgccgg ccgccccact ggccgagggt gcccacatca tcagcgtgac cgcgactgat      1260
     gcagcgggta atatcagcgc cgcttcgccc ccctttgcct ttgcggtcga tacgatcgcc      1320
     cctgcagccc ctgtcctggg accaaccgac ggaacgacga tttccggcac tgccgaaatc      1380
     ggtgcgacga tagagctgga caccgatggg gacggcattg ccgatgcgac gacgacagcc      1440
     gacgccaatg gtgagtggcg catcattctg ccgacatcgc tggcgaacgg cacccaggtc      1500
     agcgcaacgg cgacggatgc ggcaggaaac cggtccggtc ccggctcggc catcgtggat      1560
     accggcctcg acacgactcc tccggccata ccgatcctgg gcagcgtcac ggacgatgtc      1620
     gatccggcac agggtccgct cagcaacggc ggcgcgacca acgacgttcg gccactgttg      1680
     gcgggcggcg gcgtcgaagc aggcgcgacc atttccattt atgacggcgg cacggtgatc      1740
     ggcacgacaa cggccgatgg cgccggtaac tggaccttca ctccgaccga cgccctgggt      1800
     gagggcgcgc acagcctgac cgtgacggca accgacgcct tcggcaatga gagcgacgcc      1860
     tctccagcct ttgtgctgac ggtcgatacc gtcgcgccag acacgcctac gatccgcccg      1920
     agcaatggcg ctggattgag cggcatggcg gagccggggg caacgatcaa tctggatctg      1980
     aacggcgacg gcacggtcga tgtcacggtc acagccgatg gaacgggtga gtggcaatat      2040
     gtccccgacg cccggctgcc cgacggtgct acggtcatcg tcacggcaag cgaccccgcg      2100
     ggcaaccttt ccccgccagc atcgcgcgtg gtggacgctg acgtgccggt ggcgcccgtc      2160
     atcaccggca tcgtcgacga tgtcgcgccg atcatcggcg ggctggccaa tggcgcaagc      2220
     tcgaatgacg tccagccgac cttcagcggc acggcggaag caggatcgac ggtctatctt      2280
     tacgacaatg gcgcgcagat cggcacggcg gcggccgatg gcagcggcaa ctggaccttc      2340
     acgcccgctg ccctgaccga tggcgcgcac agcttttccg tcacggcaac ggatgaagca      2400
     ggcaatatct cgggtccgtc atcccccttc gtgatcacgg tggacaccgc tgcccctgcc      2460
     gcgcccgcca tgaaccctac ggacggcaac accatatccg gcacggccga ggcgggggcc      2520
     acgatcgcca tcgacatcaa tggcgatgga gcggccgacg cgaccacgac cgccaacagt      2580
     gcgggcgaat ggtcggtcgg ccttggcacg ccactgggga acggcactct cgtcagcgcg      2640
     acggcaagcg acagcgcggg caacagttct ggaccttcaa cagtaaccgt cacgaccgcg      2700
     atcgacagca cgccgccgcc cattcccacc ttcgacagcg caacggacga tgtcgcccct      2760
     gtcctgtccg cgctgtccag cggcgcgacc agcaacgaca cccagccttt gctggcgggg      2820
     agcggcgtgg aagcgggcgc aaccgtttcc atctacgata atggcgtgct gctgggcaac      2880
     ggcaccgtcg atgggtcggg caactggaca ttcacgccgg gcgcgccgct gagcgagggc      2940
     gcgcacagcc tgacagtgac cgcgacggac gggtcgggca atgaaagcgc ggcatcggcc      3000
     cccttcctgc tgacgatcga taccgctgcc cccggcgcac ccacgatcag ccccagcaac      3060
     ggggatgtgc tgaccggcac ggccgaagcc ggcgcgacga tcaacatcga tctggacggc      3120
     aacgggtcgg cggacaccag cgtcaccgcc gatccatccg gcaactggac cttcgatccg      3180
     atcggcgtgg ttccagacgg gacgaccgtg atcgtcacgg ccagcgatgc ggcgggcaat      3240
     gtctccggcc cggcatcgac cgttatcgac gccatcgcac cggcggcacc cgcgatcacg      3300
     gccctgaccg atgatcaggg tggatcaacg ggcgggatct ctcccggcgc tgcgacggac      3360
     gatgatcggc ccgccatcgc cggaacggcc gacatcggcg ccacggtcct gctgttcgac      3420
     aatggcacgc agattggcac agccgccgtg gatggttcgg ggaactgggc ttttacgccc      3480
     gccatcgcct tgccggacgg gccgcatagc ttcagcgccc gcgcggttga tgctgcaggc      3540
     aatgtcagca gcctgtctgc ttccttcgcg atcacgattg atacgctttc gcccaatgcc      3600
     ggcgcgatca cgggcatcag cgacaatgtg ccgggagcaa tcggcccgat cccgaacggc      3660
     agcctgacca atgacgcgca gccgacccta tcaggcacgg cggacccagg cgagagcgtc      3720
     accatcatgg acaatggtgt cgcgatcggc accgcccccg tcgatggcct gggcgcatgg      3780
     agcttcacgc cgctcgcgcc gctgagcgat ggtgcgcaca gcttcaccat cgtgacggtg      3840
     gatgccgccg gaaacggcag cagcgcctca accgcttatg cggtgacgat cgacagcgcg      3900
     gccccggctg cgcccgtcat cgatgccgcg gcagacaata gtggatcgat caccggcacg      3960
     gtcgcggccg gaggctcgac cgacgaagtc cagccgaccc tgtcgggaac ggtcgagccg      4020
     ggatccaccg tcgccatctt cagcaacggc acgccagcgg gcaacgcgtc ggtcgatccg      4080
     gcgggcaact ggaccttcac gccggcactg ccgctggggg acggcaccta taatttcacc      4140
     gctgtcgcca ccgatccggc aggcaacagc agtggcctgt cctcaccctt taccatcacc      4200
     atcgacacgg ctgcgcccag cctgccgatc atcacccagg ccagcgacga tgtgggcggc      4260
     gcgccgaccc ccattgctcc cggcggcctg acggacgacg ccttgccggt cctgtcgggc      4320
     acgaccgagg cgcttgccac ggtcaccatc ttcgacaatg gcaccgcgat cggcaccacg      4380
     acggcggacg gttcgggcaa ctggaccttt acccccggct cccccctggc actgggcgcc      4440
     catagcatca cggcctcggc aatcgacgcg gtcggcaatg aaagccttca gggagcgcca      4500
     ttcaacttca cgctgatcgc ggtggcgggc ggcattcccg tcatcggcgg cgtgagcgac      4560
     gatgtcggcg ccgtaaacgg accggtcctg aacggcggcg tgacggacga tgccacgcct      4620
     acgctcagcg gaacgggacc ggccagcacc acgctcgcca tcttcgacaa tggcacgcag      4680
     atcggcaccg cttccaccga cggatcgggc gcgtggagct tcacgcccac caccgccctt      4740
     accgacggca cccatgatct gaccgcagcc gaagcgctgg gcggtggcgc gttcgggcct      4800
     gcgtcgggcg cgttcaccat caatgtcgac accgccgctc cggctgctcc tgccatcacg      4860
     gtggcgatcg acgatgtggc agcgttcacc ggcggcatca cggacggcgg ccttaccaac      4920
     gatagcgcgc ccgagattcg aggcacaggc gaaataggcg cgacggtgac gctgttcgac      4980
     aatggcagtc ccgtgggcac ggccgtggtt gacgccagcg gcaactggag catatctccc      5040
     gtcggcccgc ttgccgaagg gctgcacagc ttcaccgcgt cggccgccga cgaggcgggc      5100
     aatgccggtc ccctttccgc cgccttcacc ctgacggtcg acctcactcc gccgcccgcg      5160
     ccgacgatca ccgctgtcac ggacgatgtc gcccaacaga ccggcacggt cacaaatggc      5220
     ggcatcagca atgacgtgtt gccgcaaatc agcgggacgg cgatagccgg atcgaccgtc      5280
     cagatcttcg acaatggcgc gttgctgggt acgaccgttg ctgacggcgg cggcaactgg      5340
     agcttcacgc ccggcggggc gctggcgaac ggatcgcatg gcttcaccgt tgcccagctt      5400
     gacagcgccg gcaatgccag cagcccatcg ccagtctatt ccgtcaccat cgatacggtc      5460
     gcgccgaccg ccggcatcgc catcaccacc cttacccagg atacgggcgt ggtcggcgat      5520
     tggtcgacgc aggatagtgc ccccacgata gcgggcaccc tgaccgcgcc cctcagcgct      5580
     ggtgaacggg tggaaatcca gatcgatgga ggtgcctggg tttccgcgac ggccagcggg      5640
     acgagctggt tctacggccc cggtacgctt gccgtcggcc agcatggcgt caacgtccgc      5700
     gtcatcgatt ccgccgggaa tatcggcgat gtggaagcgc aacagttcac gatcaccaac      5760
     gtcaatcagg cgccgatcgt gcaggccagc ggcacttccc tgctggggct ggtgggggca      5820
     gaagcgctgg gcctgatcga tctcagcacc cagtccctca ccgcctacga tcccaacaat      5880
     aatctgcgca gcgtcgaggt gcgtttcgca cccttgctgt cggccaatct gggcgctttc      5940
     acattgacgg cttccaccgc tctggcggct gaactgggcc tgcaggtttc cattgccaac      6000
     aatcccgggc tgctgggcat cttggcgccc tcctccgtcc tgaccgtcac ggcgctcgac      6060
     ggtgggccga tcagcaatca ggccatcaat gaactgctga acacggttca tttcaatcag      6120
     gatctgacgc tgctcggcct taacgtgctg gatacgacga cgatcaccgc gaccgacatg      6180
     aatgggctga cggccagttc ggccacaggc acgcttgcca atctgagcct gctgaacgcc      6240
     agcggttcaa gcgccgtgct ggaaggcaat gccagcgcca acacgatcaa tggcacggcc      6300
     gcgaacgaaa ggctttatgg ccatggcggc gcagatacgc tgaacggcaa cggcggtaat      6360
     gaccttctgc gcggcggagc cggtgccgac acccttaatg gcgggacggg taatgatgtg      6420
     ctcgtccatg acgcggccga tgcatcgatc gatggcggaa ccggcgtcga cacgctgctg      6480
     atcgacagcg ggacggggat ggtgctgaac ctcgacgccg taaacaacat tcgcaatatc      6540
     gagcggatcg acttgggtgt cggcgatgca gggcgacaga ttacgctgac ggaagccggc      6600
     atcatccgcg ccacggaggc aagccatcaa ctgatcgtca caggcgatct caacgacagc      6660
     gtcaccatga ctggcgcaac cttgcagggg cagacgctga tcaacgggca ggccttcgat      6720
     cattacgcct tgggcaccac caacatctat gtggaggacc ctgtaatggt cgttgtctga      6780
//

If you have problems or comments...

PBIL Back to PBIL home page