(data stored in ACNUC7421 zone)

EMBL: AP010803.PE703

AP010803.PE703       Location/Qualifiers
FT   CDS_pept        complement(713679..713972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-07030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95537"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV5"
FT                   /protein_id="BAI95537.1"
FT                   /translation="MKICRGVSASAPGGGLGPGRTGAAPTRVTLLLKCSTVAQRTLSSS
FT                   IIHGVTTRTLTSMFSFLSAANAAVGKAKRLPTSGETRKRIFMSSKTDQQNSS"
     atgaaaatct gcaggggcgt ttctgcttca gccccaggag ggggtttagg accaggcaga        60
     acgggagccg ccccgacccg cgtgactctg ctattgaaat gctcaactgt ggcgcagcgc       120
     actctctcta gctcaatcat acatggcgta acgacccgta cgctcacctc catgttcagt       180
     tttttatcag ctgccaatgc cgcggtgggc aaggccaaga gactgccgac cagcggcgaa       240
     accaggaagc gaatattcat gagctccaaa acggatcagc agaatagttc ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page