(data stored in SCRATCH zone)

EMBL: AP010803.PE704

AP010803.PE704       Location/Qualifiers
FT   CDS_pept        714165..714665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-07040"
FT                   /product="spore coat protein U"
FT                   /note="uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95538"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV6"
FT                   /protein_id="BAI95538.1"
FT                   /translation="MDHCAKRLMTAITMAALCAISPGQAATTTTTFPVTASVLTACAVS
FT                   ANPLNFGNYDPTSATPLDATTNLSVLCTVGTSFTVGLNAGAASGATVTARRMVNGANIL
FT                   NYALYREAARTNIWGNTPGTDMPPATTAPILPTALTVYGRIPAGQNVPAGGYADTVTVT
FT                   VNY"
     atggaccatt gcgccaagcg tttgatgact gcgatcacaa tggctgcgtt atgcgccata        60
     tctccaggcc aagccgcaac cacgacgacg acttttccgg taacggcttc ggtgctgacg       120
     gcctgcgcgg tcagtgccaa ccctcttaat ttcggcaatt atgatccgac ctctgcgacg       180
     cctctggatg cgacgacaaa cctgtcggtc ctgtgcaccg tggggacgtc gtttacagta       240
     ggcttgaacg ccggggcagc gagcggagca acggtcacgg cccgccgcat ggtcaatggc       300
     gccaacatcc tgaactacgc gctttaccgg gaagcggccc gcaccaacat atggggcaac       360
     acgccgggaa cggatatgcc gcccgcgacc accgcgccaa tattgccgac agcgctcacc       420
     gtttacgggc gcattcccgc gggccaaaat gtgcccgccg gaggctatgc cgacactgtc       480
     actgtcaccg tgaattactg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page