(data stored in SCRATCH zone)

EMBL: AP010803.PE707

AP010803.PE707       Location/Qualifiers
FT   CDS_pept        717704..718189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-07070"
FT                   /product="putative secreted pili protein"
FT                   /note="uncharacterized secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95541"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV9"
FT                   /protein_id="BAI95541.1"
FT                   /translation="MRRVRWLFAPFVALSVPTPAEAACNGLAGCSCTVTASGVSFGNYN
FT                   PLSSTPSDVTGTVQVNCTLLLALAGSFTVDLSAGGSGAFSQRRLRRGTDSLAYNLYTDA
FT                   ARTQIWGDGTGGSTRVTRNFAALLNFTDTMTVYARLPARQNVSAGSYSDTMIVTVTY"
     atgagaaggg taaggtggct gttcgcgccg tttgtcgccc tgtcagttcc caccccggcg        60
     gaggcggcgt gcaatggcct tgcgggctgt tcctgcacgg ttaccgcctc cggggtcagt       120
     ttcggcaact acaatcctct ttcctccact cctagtgacg tgacggggac agtgcaggtc       180
     aactgcactt tgctgcttgc gctcgcgggg tcgttcacgg tcgatctgag cgccggcggt       240
     tcaggcgcct tttcgcagcg aaggctaagg cggggtacag acagtctcgc ctataatctc       300
     tacacggatg ccgcccggac ccagatttgg ggcgacggca cgggcggatc gacgcgcgtc       360
     actcgcaatt tcgccgcgct attgaacttt accgatacga tgacggtgta cgctaggcta       420
     cccgcaaggc agaatgtctc cgcaggcagc tatagcgaca cgatgattgt gactgtgacc       480
     tattag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page