(data stored in ACNUC7421 zone)

EMBL: AP010803.PE71

AP010803.PE71        Location/Qualifiers
FT   CDS_pept        complement(73988..74749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00710"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94905"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX23"
FT                   /protein_id="BAI94905.1"
FT                   /translation="MVELLRAAGLGDVLHGFAGRRGGVSTGVHAGLNVGLGSEDERDAV
FT                   LRNRDLARDALLPGATLVTVHQVHSPDAVTVTAPIAADERPAADAMVTNRSGLILGILT
FT                   ADCVPVLFADASAGVIGAAHAGWKGALGGVTDRTIGAMEALGAGRDRIACAIGPCIGRS
FT                   SYEVTLDFAERFAAADAENDRFFSAGREGHCQFDIAAYVAARLAGAGIGQIELLDEDTY
FT                   SQPDRFYSYRRSCHRGEADYGRQISMIALRD"
     gtggttgaat tgctgcgggc ggcaggttta ggggatgtcc tgcacgggtt tgcgggacgg        60
     cgcggcggcg tttcgacagg ggttcatgcg ggcctgaacg tcgggctggg gtcggaggat       120
     gagcgggacg cggttctgcg caaccgggat ctggcgcgcg acgccttgct ccccggcgcg       180
     acgctggtga cggtgcatca ggtgcactcg cccgatgcgg tcacggtcac ggcgcccatc       240
     gccgctgacg aacggccggc ggcagacgcc atggtgacga atcgctctgg actgattttg       300
     ggaatactca ccgccgattg cgtgcctgtg ctgtttgccg atgcttcggc cggcgtcatc       360
     ggtgcggcgc atgcggggtg gaaaggcgcc ctgggcggag tcacggaccg gacgatcggc       420
     gcgatggagg cgctgggcgc tgggcgcgac cggatcgcct gcgcgatcgg gccgtgcatc       480
     gggcgttcct cctatgaggt gacgctggat ttcgcggaac gcttcgcagc ggcggatgcg       540
     gagaatgatc gcttcttctc ggcaggacgg gaagggcatt gccaattcga cattgccgcc       600
     tatgtggctg cgcggctcgc gggcgcgggg atcggccaga tcgaactgct ggatgaagat       660
     acctatagcc agccggatcg cttttacagc tatcggcgct cctgccatcg gggggaagcc       720
     gattatggcc ggcagatttc gatgatcgct ttgcgggatt ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page