(data stored in ACNUC7421 zone)

EMBL: AP010803.PE72

AP010803.PE72        Location/Qualifiers
FT   CDS_pept        74915..76531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00720"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94906"
FT                   /db_xref="GOA:D4YX24"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX24"
FT                   /protein_id="BAI94906.1"
FT                   /translation="MIFGRIKPLDAILATAEKKSLVRTLGPVQLTLLGVGAIIGTGIFV
FT                   LTAAAAQKAGPGMMWSFVIAGAVCAFAALCYSEIASMVPVSGSAYTYTYAVVGELLAWM
FT                   VGWALILEYAVAASAVSVGWSGYFMGLLKSITGLELPQALSAGPVWTMNGLVPHADITH
FT                   GLINIPAIVIALAVTALLVIGTTESARVNAVLVAIKVTALTAFILLTLPVLDTGNFSPF
FT                   APNGWFGPEGASGMGIVGAAASIFFAYVGFDAVSTAAEETKNPQRNVPIGLIGSLALCT
FT                   VFYLLVAGGAIGAIGAQPVLGPDGSVVAPGSQGFAAACATAAHAQDLVCSNEALAHVLR
FT                   EINWTVVGNALGLAANLALPSVILMMMFGQTRIFFVMARDGLLPEKLASIHPRFKTPHV
FT                   VTMVTGVFVAIGAALLPVGQLADISNSGTLFAFFMVSIAVLVLRVKEPGRARPFRTPLV
FT                   WVIAPMAAFGCVFLFFNLPFDAQLVLPIWGGIGLVLYFIYGYRKSHVGRGLVETHEQDA
FT                   GIPPQPVPPMPGAHTPGGRDA"
     atgatcttcg ggcgcataaa gccattggac gccatattgg ccacggccga gaagaaatct        60
     ctcgtccgta ccctggggcc ggttcaactg acgctattgg gtgtcggcgc gatcatcggc       120
     accggcatct tcgtcctgac cgccgccgcc gcgcaaaagg ccggaccggg catgatgtgg       180
     agcttcgtga tcgcgggggc cgtctgcgcc ttcgccgcgc tctgctattc cgagatcgcg       240
     tcgatggtgc ccgtatcggg ttccgcctat acctatacct atgcggtggt cggcgaattg       300
     ctcgcctgga tggtgggatg ggcgctcatc ctggaatatg cggtcgcggc cagcgccgtt       360
     tcggtcggct ggtcaggcta tttcatggga ttgctcaaaa gcataaccgg gcttgagctg       420
     ccgcaggcgc tttcggcggg gccggtgtgg acgatgaacg gcctggtccc gcatgccgac       480
     atcacccatg gcctcatcaa cattcccgcc atcgtcatcg ccctggcggt caccgccctg       540
     ctggtgatcg gcaccacgga aagcgcccgc gtcaacgccg tgctcgtcgc catcaaggtg       600
     acagcgctca ccgccttcat ccttctgacc ctccccgtgc tcgacaccgg caatttctcg       660
     cctttcgcgc ccaatggctg gttcgggccg gaaggcgcca gcggcatggg catcgtcggc       720
     gccgccgcct cgatcttctt cgcctatgtc ggcttcgacg ccgtgtcgac cgcggcggag       780
     gaaaccaaga acccgcagcg caacgtgccc atcggcctga tcggcagcct ggcgctctgc       840
     accgtcttct acctgctggt ggcgggcggc gcgatcggcg cgatcggcgc gcagccggtg       900
     cttggccccg acggttctgt cgtcgcgccc ggatcgcagg gcttcgccgc cgcctgcgcg       960
     accgccgccc atgcccagga cctcgtctgc tccaacgaag cgcttgccca tgtgctgcgc      1020
     gagatcaact ggacggtcgt gggcaatgcc ctgggccttg ccgccaacct ggcgctgccg      1080
     tcggtcatcc tgatgatgat gttcggccag acccgcatct tcttcgtgat ggcgcgcgac      1140
     ggcctgctgc ccgaaaagct cgccagcatc catccccgtt tcaagacgcc ccatgtcgtc      1200
     accatggtga cgggcgtctt cgtcgccatc ggcgccgctc tgctgcccgt gggccagctt      1260
     gcggacatct ccaattccgg cacgctgttc gccttcttca tggtgtccat cgccgtgctg      1320
     gtgttgcgcg tgaaggaacc gggccgcgcc cgtccgttcc gcacccccct ggtgtgggtg      1380
     atcgcgccca tggcggcctt cggctgcgtc ttcctcttct tcaacctgcc gttcgatgcc      1440
     cagctcgtcc tgccgatctg gggcggaatc ggcctcgttc tctatttcat ctacggctat      1500
     cgcaagagcc atgtggggcg cggactggtc gaaacccatg aacaggatgc cggcattccg      1560
     ccccagcccg tgccgccgat gccgggtgcg catacgccgg gcggacggga cgcctga         1617
//

If you have problems or comments...

PBIL Back to PBIL home page